Transcription Factor (TF) Information

General Information of This TF
TF ID
TFD0060
TF name
High mobility group protein HMG-I/HMG-Y (HMGA1)
Synonyms
HMG-I(Y); HMGA1; HMGIY; High mobility group AT-hook protein 1; High mobility group protein A1; High mobility group protein R
Gene Name
HMGA1
Gene ID
3159
TF Classification Superclass beta-Sheet binding to DNA
Class A.T hook factors
Family HMGA factors
Subfamily Other factors
Function This transcription factor is involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions.
Sequence
MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGR
PKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
Uniprot ID
HMGA1_HUMAN
Ensembl ID
ENSG00000137309
HGNC ID
HGNC:5010
Drug Transporter(s) Regulated by This TF

Activation

GLUT3

 Transporter Info

Colon cancer [ICD11: 2B90]

 [1]
Disease-specific Protein Abundances of TF
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.051292406; Fold-change: 0.231184589; Z-score: 0.487907571
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.050869353; Fold-change: 0.273007775; Z-score: 2.503925822
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.68122272; Fold-change: 0.017064458; Z-score: 0.117228591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.25E-14; Fold-change: -0.258606368; Z-score: -0.781760092
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.454123917; Fold-change: -0.114910453; Z-score: -0.552593919
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.791544338; Fold-change: -0.007966544; Z-score: -0.030194257
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.52E-10; Fold-change: -0.407241148; Z-score: -1.248614775
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.26E-18; Fold-change: -0.308305766; Z-score: -0.59882998
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.487534993; Fold-change: 0.277785376; Z-score: 0.760336967
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001060044; Fold-change: 0.733907157; Z-score: 1.461631323
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.830148507; Fold-change: 0.186983794; Z-score: 0.47268716
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.860746088; Fold-change: -0.143687371; Z-score: -0.985736112
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001658893; Fold-change: -0.16645976; Z-score: -1.123590167
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.009335949; Fold-change: 0.106087291; Z-score: 0.485386247
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.030397644; Fold-change: 0.3453146; Z-score: 1.551056597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.619175456; Fold-change: -0.046033456; Z-score: -0.229399424
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.208290457; Fold-change: -0.46918757; Z-score: -0.994622768
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003743812; Fold-change: 0.361280806; Z-score: 1.227389605
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.50E-18; Fold-change: 0.406221518; Z-score: 1.002801436
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.874833237; Fold-change: 0.083145826; Z-score: 0.236458874
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.009302531; Fold-change: 0.21864296; Z-score: 0.40463464
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.999149786; Fold-change: -0.104488904; Z-score: -0.341693021
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.197590803; Fold-change: 0.541549518; Z-score: 0.858191157
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000448472; Fold-change: 0.537229925; Z-score: 1.189097517
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.60E-17; Fold-change: 0.360774747; Z-score: 0.948479556
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 4.82E-35; Fold-change: 0.606295545; Z-score: 1.500280688
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.55E-06; Fold-change: 0.661112003; Z-score: 3.692885249
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.40E-06; Fold-change: 0.882821802; Z-score: 4.713107822
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000177165; Fold-change: 0.502744674; Z-score: 1.316746267
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.001436986; Fold-change: 0.210640167; Z-score: 0.508487665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.06E-24; Fold-change: 0.607058537; Z-score: 2.318945927
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.27E-43; Fold-change: 0.544447167; Z-score: 1.590644289
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.020140928; Fold-change: 0.67351208; Z-score: 2.034889221
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
Download TF expression data in the tissue of the other disease section
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.28E-57; Fold-change: 0.606567925; Z-score: 1.644866168
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 4.67E-22; Fold-change: 0.535023296; Z-score: 1.207930264
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.053476826; Fold-change: 0.099451329; Z-score: 0.250359196
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.48E-31; Fold-change: 0.441416966; Z-score: 1.062280918
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 8.54E-15; Fold-change: 0.289559087; Z-score: 0.651490988
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.51E-57; Fold-change: 0.569449469; Z-score: 1.309088681
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.001317691; Fold-change: 0.308737528; Z-score: 0.48260864
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000135194; Fold-change: 1.85042586; Z-score: 2.57442196
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.093457578; Fold-change: 1.322718863; Z-score: 0.931173101
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000204927; Fold-change: 0.201257796; Z-score: 1.036218375
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001039068; Fold-change: 0.291155978; Z-score: 0.476895751
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.004044658; Fold-change: -1.139305559; Z-score: -2.670367342
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.01009393; Fold-change: 0.273672865; Z-score: 0.393881904
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.040267703; Fold-change: -0.321310235; Z-score: -0.806862432
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.51E-05; Fold-change: -0.301694737; Z-score: -0.754584346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.312254925; Fold-change: 0.062096499; Z-score: 0.26284217
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.004609944; Fold-change: 1.052214337; Z-score: 2.077342861
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.008563448; Fold-change: 0.334191124; Z-score: 2.125597486
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.54E-07; Fold-change: 0.286723912; Z-score: 0.719360277
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.64E-06; Fold-change: 0.419508574; Z-score: 0.778968146
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.897650193; Fold-change: -0.119475115; Z-score: -0.6355187
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of the other disease section
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000184223; Fold-change: 0.488256688; Z-score: 1.841493014
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.354467131; Fold-change: 0.127302889; Z-score: 0.556107295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.169218205; Fold-change: 0.052080468; Z-score: 0.130611197
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.081769616; Fold-change: 0.187718384; Z-score: 0.734040714
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.035396049; Fold-change: -0.339815654; Z-score: -1.415733326
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.11581773; Fold-change: -0.102398281; Z-score: -0.729160522
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.694397672; Fold-change: 0.162574061; Z-score: 0.247236324
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.034753108; Fold-change: 0.239336477; Z-score: 0.94605206
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.59E-05; Fold-change: -0.177232163; Z-score: -0.468402724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.020700694; Fold-change: 0.039601617; Z-score: 0.246079992
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.245114304; Fold-change: 0.17018578; Z-score: 0.720877922
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000217651; Fold-change: -1.005250875; Z-score: -4.79867779
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.495014146; Fold-change: -0.004948887; Z-score: -0.023051526
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.874556967; Fold-change: 0.151857284; Z-score: 0.342090813
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.907949344; Fold-change: -0.098409767; Z-score: -0.135939819
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.316787315; Fold-change: 0.005982806; Z-score: 0.038975407
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.084085132; Fold-change: -0.326045892; Z-score: -1.249038533
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.444884684; Fold-change: -0.121544241; Z-score: -0.462204489
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.147393041; Fold-change: 0.07602029; Z-score: 0.377128074
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.104748534; Fold-change: -0.076984738; Z-score: -0.923420277
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.207190904; Fold-change: 0.038822865; Z-score: 0.191160854
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.008857713; Fold-change: 0.171525694; Z-score: 0.791345094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001042996; Fold-change: -0.261753037; Z-score: -0.836528747
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.344694705; Fold-change: 0.032688259; Z-score: 0.112105223
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.9060555; Fold-change: -0.054053437; Z-score: -0.345695298
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.241956799; Fold-change: -0.047518605; Z-score: -0.327184464
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.970571665; Fold-change: 0.023428016; Z-score: 0.136064907
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.665034823; Fold-change: -0.006803524; Z-score: -0.050921805
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.272188229; Fold-change: -0.045480385; Z-score: -0.123389142
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.111905191; Fold-change: -0.0845538; Z-score: -0.456023883
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.03E-06; Fold-change: -0.130115776; Z-score: -0.453851798
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.710748255; Fold-change: 0.01649417; Z-score: 0.0621715
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.04820997; Fold-change: 0.188981522; Z-score: 1.228587873
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.323407187; Fold-change: -0.065165151; Z-score: -0.769107502
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.744608614; Fold-change: -0.177233041; Z-score: -0.679470761
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of the other disease section
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.724591156; Fold-change: 0.14086818; Z-score: 0.278020302
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.205512046; Fold-change: 0.163432239; Z-score: 0.373185324
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.48E-09; Fold-change: -0.281444207; Z-score: -1.987712231
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.422074975; Fold-change: 0.031989703; Z-score: 0.108184113
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.93524742; Fold-change: 0.142087082; Z-score: 0.266463332
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.237758886; Fold-change: -0.063486809; Z-score: -0.337400514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.012456293; Fold-change: -0.384079683; Z-score: -1.507783942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002007197; Fold-change: -0.336700926; Z-score: -0.759636896
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 09 Disease of the visual system
             [+] ICD-11: 9A96 Anterior uveitis Click to Show/Hide the Full List
The Studied Tissue Peripheral monocyte
The Specified Disease Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.679997893; Fold-change: -0.251692611; Z-score: -0.556724391
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 11 Disease of the circulatory system
             [+] ICD-11: BA41 Myocardial infarction Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.646083005; Fold-change: -0.096453012; Z-score: -0.147816774
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: BA80 Coronary artery disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.017462771; Fold-change: 0.290228716; Z-score: 1.881698247
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: BB70 Aortic valve stenosis Click to Show/Hide the Full List
The Studied Tissue Calcified aortic valve
The Specified Disease Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.587102757; Fold-change: 0.164249342; Z-score: 0.302429775
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.169004376; Fold-change: 0.112935361; Z-score: 1.04843374
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.363477369; Fold-change: 0.200971457; Z-score: 0.854790505
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.032645656; Fold-change: 0.171914524; Z-score: 0.426062394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.384117463; Fold-change: -0.050245018; Z-score: -0.107413982
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.206050964; Fold-change: -0.194691031; Z-score: -0.622707588
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.015703123; Fold-change: 0.20073844; Z-score: 0.36295127
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.48706645; Fold-change: 0.431535933; Z-score: 0.887343631
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.16683892; Fold-change: 0.135464445; Z-score: 0.302091493
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.008088665; Fold-change: 0.513351977; Z-score: 4.769754176
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.540580094; Fold-change: 0.149748517; Z-score: 0.62497194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.48E-09; Fold-change: 0.74434806; Z-score: 5.854536986
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.043176392; Fold-change: 0.157558389; Z-score: 0.739967586
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of the other disease section
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.751378413; Fold-change: 0.044966538; Z-score: 0.225965642
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.020760396; Fold-change: 0.107305843; Z-score: 0.534033878
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.81E-11; Fold-change: 0.366476394; Z-score: 0.809811648
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.155309574; Fold-change: 0.032182725; Z-score: 0.098796318
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.018448017; Fold-change: 0.244887013; Z-score: 1.32992556
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.009405841; Fold-change: -0.05277677; Z-score: -0.178922351
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.664648698; Fold-change: 0.135164803; Z-score: 0.496369331
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.015120976; Fold-change: -0.20159478; Z-score: -1.254524076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.761498903; Fold-change: 0.085909799; Z-score: 0.127878131
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003871098; Fold-change: 0.527887346; Z-score: 1.173056266
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.341230472; Fold-change: 0.044129048; Z-score: 0.192084604
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.803466966; Fold-change: -0.099810623; Z-score: -1.083236228
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.146687714; Fold-change: 1.260951184; Z-score: 1.394544342
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 16 Disease of the genitourinary system
             [+] ICD-11: GA10 Endometriosis Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.047139302; Fold-change: -0.298551284; Z-score: -0.522783016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: GC00 Cystitis Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.851180533; Fold-change: 0.146753215; Z-score: 0.349029097
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 19 Certain condition originating in the perinatal period
             [+] ICD-11: KA21 Short gestation disorder Click to Show/Hide the Full List
The Studied Tissue Myometrium
The Specified Disease Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.16086433; Fold-change: -0.14353739; Z-score: -0.272218524
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 20 Developmental anomaly
             [+] ICD-11: LD2C Overgrowth syndrome Click to Show/Hide the Full List
The Studied Tissue Adipose tissue
The Specified Disease Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.237842192; Fold-change: 0.065698077; Z-score: 0.371048737
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Perituberal tissue
The Specified Disease Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.226443465; Fold-change: -0.196038433; Z-score: -2.974689677
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
References
1 Caveolin-1 increases aerobic glycolysis in colorectal cancers by stimulating HMGA1-mediated GLUT3 transcription. Cancer Res. 2012 Aug 15;72(16):4097-109.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.