Transcription Factor (TF) Information

General Information of This TF
TF ID	TFD0083
TF name	Transcription factor MafB (MAFB)
Synonyms	KRML; MAFB; Maf-B; V-maf musculoaponeurotic fibrosarcoma oncogene homolog B
Gene Name	MAFB
Gene ID	9935
TF Classification	Superclass	Basic domains
	Class	Basic leucine zipper factors
	Family	Maf-related factors
	Subfamily	Large Maf factors
Function	This transcription factor is a transcriptional activator or repressor. Plays a pivotal role in regulating lineage-specific hematopoiesis by repressing ETS1-mediated transcription of erythroid- specific genes in myeloid cells. Together with PAX6, transactivates weakly the glucagon gene promoter through the G1 element.
Sequence	MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPL STPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQP LQSFDSFRGAHHHHHHHHPHPHHAYPGAGVAHDELGPHAHPHHHHHHQASPPPSSAASPA QQLPTSHPGPGPHATASATAAGGNGSVEDRFSDDQLVSMSVRELNRHLRGFTKDEVIRLK QKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKCEK LANSGFREAGSTSDSPSSPEFFL
Uniprot ID	MAFB_HUMAN
Ensembl ID	ENSG00000204103
HGNC ID	HGNC:6408

Drug Transporter(s) Regulated by This TF
Activation
GLUT2	Transporter Info	Diabetes mellitus [ICD11: 5A10-5A14]	[1]
Repression
SGLT5	Transporter Info	Diabetes mellitus [ICD11: 5A10-5A14]	[1]

Disease-specific Protein Abundances of TF
ICD-11: 01 Certain infectious or parasitic disease
[+] ICD-11: 1C1H Necrotising ulcerative gingivitis		Click to Show/Hide the Full List
The Studied Tissue	Gingival tissue
The Specified Disease	Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.49E-13; Fold-change: -0.308094765; Z-score: -1.122959136
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1E30 Influenza		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000214181; Fold-change: -1.361241; Z-score: -6.375589803
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1E51 Chronic viral hepatitis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.837203667; Fold-change: -0.953341807; Z-score: -0.373104804
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1G41 Sepsis with septic shock		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.69E-32; Fold-change: 0.813591671; Z-score: 1.310073399
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA40 Respiratory syncytial virus infection		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000166151; Fold-change: 1.31767645; Z-score: 1.276088195
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA42 Rhinovirus infection		Click to Show/Hide the Full List
The Studied Tissue	Nasal epithelium tissue
The Specified Disease	Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000503897; Fold-change: 0.339769444; Z-score: 0.998507068
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: KA60 Neonatal sepsis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.11E-22; Fold-change: 1.244071741; Z-score: 1.691041615
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 02 Neoplasm
[+] ICD-11: 2A00 Brain cancer		Click to Show/Hide the Full List
The Studied Tissue	Nervous tissue
The Specified Disease	Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.43E-90; Fold-change: 1.145446489; Z-score: 1.320520565
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.65318435; Fold-change: -0.111566455; Z-score: -0.447537295
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	White matter tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.719773688; Fold-change: 0.035397933; Z-score: 0.072591538
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.144048502; Fold-change: 0.159165043; Z-score: 0.208734448
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A20 Myeloproliferative neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.7992912; Fold-change: 0.108361796; Z-score: 0.247804147
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.885055078; Fold-change: -0.031938494; Z-score: -0.073044769
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A36 Myelodysplastic syndrome		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.009281385; Fold-change: 1.523382647; Z-score: 0.965280912
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.084291063; Fold-change: 2.104011534; Z-score: 1.378073088
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A81 Diffuse large B-cell lymphoma		Click to Show/Hide the Full List
The Studied Tissue	Tonsil tissue
The Specified Disease	Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.969067969; Fold-change: -0.020791275; Z-score: -0.041258229
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A83 Plasma cell neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.150220075; Fold-change: 0.089200898; Z-score: 0.120532759
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Bone marrow
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.287099718; Fold-change: -0.918210723; Z-score: -0.640605527
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B33 Leukaemia		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.28E-08; Fold-change: -0.84540475; Z-score: -0.860350018
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B6E Oral cancer		Click to Show/Hide the Full List
The Studied Tissue	Oral tissue
The Specified Disease	Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001061698; Fold-change: 0.73717929; Z-score: 0.857478869
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.11272581; Fold-change: -0.088666404; Z-score: -0.195040489
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B70 Esophageal cancer		Click to Show/Hide the Full List
The Studied Tissue	Esophagus
The Specified Disease	Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.194636106; Fold-change: 0.325735891; Z-score: 1.232450411
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: 2B72 Stomach cancer		Click to Show/Hide the Full List
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.145647014; Fold-change: 0.903485457; Z-score: 1.384145969
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.637629084; Fold-change: 0.091157115; Z-score: 0.178546964
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B90 Colon cancer		Click to Show/Hide the Full List
The Studied Tissue	Colon tissue
The Specified Disease	Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.065931779; Fold-change: -0.216511732; Z-score: -0.286588056
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.022468708; Fold-change: 0.076763342; Z-score: 0.112817727
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B92 Rectal cancer		Click to Show/Hide the Full List
The Studied Tissue	Rectal colon tissue
The Specified Disease	Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.005451206; Fold-change: -0.478508494; Z-score: -1.520435616
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.288433959; Fold-change: -0.262302776; Z-score: -0.592117976
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C10 Pancreatic cancer		Click to Show/Hide the Full List
The Studied Tissue	Pancreas
The Specified Disease	Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.920836193; Fold-change: 0.35108741; Z-score: 0.549736181
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.586434563; Fold-change: 0.442882492; Z-score: 0.354559584
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C12 Liver cancer		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.63E-06; Fold-change: -0.402882492; Z-score: -0.813799262
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.40E-21; Fold-change: -0.588598725; Z-score: -1.242718962
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.003824729; Fold-change: -1.073709849; Z-score: -3.94772237
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual Download TF expression data in the tissue of the other disease section
[+] ICD-11: 2C25 Lung cancer		Click to Show/Hide the Full List
The Studied Tissue	Lung tissue
The Specified Disease	Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.71E-11; Fold-change: -0.202679001; Z-score: -0.415215027
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.63E-13; Fold-change: -0.283849732; Z-score: -0.690013609
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C30 Skin cancer		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.568315739; Fold-change: 0.114589989; Z-score: 0.106210301
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Skin
The Specified Disease	Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.13E-64; Fold-change: -1.255008813; Z-score: -2.353944573
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.64E-05; Fold-change: -0.151690303; Z-score: -0.251092906
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C6Z Breast cancer		Click to Show/Hide the Full List
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.40E-06; Fold-change: -0.189519099; Z-score: -0.35903112
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.88959066; Fold-change: 0.024212378; Z-score: 0.041201886
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C73 Ovarian cancer		Click to Show/Hide the Full List
The Studied Tissue	Ovarian tissue
The Specified Disease	Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000452553; Fold-change: 1.061165508; Z-score: 2.196904868
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.015138983; Fold-change: 0.955429009; Z-score: 0.534047197
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C77 Cervical cancer		Click to Show/Hide the Full List
The Studied Tissue	Cervical tissue
The Specified Disease	Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001274569; Fold-change: -0.637177407; Z-score: -1.077206383
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C78 Uterine cancer		Click to Show/Hide the Full List
The Studied Tissue	Endometrium tissue
The Specified Disease	Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.70E-05; Fold-change: 0.517150929; Z-score: 0.538897469
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.0004274; Fold-change: 2.990888913; Z-score: 4.239811356
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C82 Prostate cancer		Click to Show/Hide the Full List
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.006611018; Fold-change: -0.445365096; Z-score: -0.732101128
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C90 Renal cancer		Click to Show/Hide the Full List
The Studied Tissue	Kidney
The Specified Disease	Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.270047345; Fold-change: 1.097035958; Z-score: 0.777752165
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.40E-28; Fold-change: 1.090581112; Z-score: 2.244347926
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C92 Ureter cancer		Click to Show/Hide the Full List
The Studied Tissue	Urothelium
The Specified Disease	Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.414923752; Fold-change: 0.224703702; Z-score: 0.368870554
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C94 Bladder cancer		Click to Show/Hide the Full List
The Studied Tissue	Bladder tissue
The Specified Disease	Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000349367; Fold-change: -0.963940755; Z-score: -2.686882142
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D02 Retinal cancer		Click to Show/Hide the Full List
The Studied Tissue	Uvea
The Specified Disease	Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.00E-07; Fold-change: 3.161020554; Z-score: 6.465192401
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D10 Thyroid cancer		Click to Show/Hide the Full List
The Studied Tissue	Thyroid
The Specified Disease	Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.05E-38; Fold-change: -1.02900788; Z-score: -1.783566609
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.28E-14; Fold-change: -0.905567427; Z-score: -1.431618666
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D11 Adrenal cancer		Click to Show/Hide the Full List
The Studied Tissue	Adrenal cortex
The Specified Disease	Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.051003172; Fold-change: 0.266175915; Z-score: 0.622554342
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
[+] ICD-11: 2D12 Endocrine gland neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.52038204; Fold-change: -0.46562178; Z-score: -0.529732737
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.038108211; Fold-change: -0.476246703; Z-score: -0.633500155
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D42 Head and neck cancer		Click to Show/Hide the Full List
The Studied Tissue	Head and neck tissue
The Specified Disease	Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.01E-24; Fold-change: 1.361657487; Z-score: 1.359656456
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 03 Disease of the blood or blood-forming organs
[+] ICD-11: 3A51 Sickle cell disorder		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.006367056; Fold-change: -0.869888787; Z-score: -1.351729867
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3A70 Aplastic anaemia		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.209761543; Fold-change: -0.953843727; Z-score: -0.884372614
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3B63 Thrombocytosis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.192596553; Fold-change: -0.091904527; Z-score: -0.210907714
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3B64 Thrombocytopenia		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.890638911; Fold-change: 0.162129826; Z-score: 0.215170144
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 04 Disease of the immune system
[+] ICD-11: 4A00 Immunodeficiency		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.038855383; Fold-change: 0.256844483; Z-score: 0.8832178
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A40 Lupus erythematosus		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.853335493; Fold-change: 0.128526234; Z-score: 0.085506802
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A42 Systemic sclerosis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.006295074; Fold-change: 0.544309178; Z-score: 1.25805797
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A43 Systemic autoimmune disease		Click to Show/Hide the Full List
The Studied Tissue	Salivary gland tissue
The Specified Disease	Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.204640351; Fold-change: 0.249060179; Z-score: 0.828270747
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.124280589; Fold-change: 0.551495597; Z-score: 0.86290234
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A62 Behcet disease		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.181150994; Fold-change: 0.346424748; Z-score: 0.827063932
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4B04 Monocyte count disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.010960277; Fold-change: 1.009722169; Z-score: 0.921706607
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 05 Endocrine, nutritional or metabolic disease
[+] ICD-11: 5A11 Type 2 diabetes mellitus		Click to Show/Hide the Full List
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.373997481; Fold-change: -0.086080136; Z-score: -0.484629262
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.021075359; Fold-change: 0.060751713; Z-score: 0.232372368
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Liver tissue
The Specified Disease	Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.497108956; Fold-change: 0.202423308; Z-score: 0.683877499
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5A80 Ovarian dysfunction		Click to Show/Hide the Full List
The Studied Tissue	Vastus lateralis muscle
The Specified Disease	Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.463769962; Fold-change: -0.028754413; Z-score: -0.056259562
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder		Click to Show/Hide the Full List
The Studied Tissue	Biceps muscle
The Specified Disease	Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.246824468; Fold-change: 0.015071159; Z-score: 0.041853124
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C56 Lysosomal disease		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.530899948; Fold-change: 0.16490301; Z-score: 0.322434595
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C80 Hyperlipoproteinaemia		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.140619802; Fold-change: -1.002523632; Z-score: -1.046873893
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.46E-13; Fold-change: 2.123183149; Z-score: 2.069142687
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
[+] ICD-11: 6A02 Autism spectrum disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.009356064; Fold-change: 0.44406324; Z-score: 0.827268797
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A20 Schizophrenia		Click to Show/Hide the Full List
The Studied Tissue	Prefrontal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.150149032; Fold-change: 0.103448477; Z-score: 0.084809219
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Superior temporal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.170798576; Fold-change: 0.069487535; Z-score: 0.200010193
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A60 Bipolar disorder		Click to Show/Hide the Full List
The Studied Tissue	Prefrontal cortex
The Specified Disease	Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.452229005; Fold-change: 0.058394731; Z-score: 0.096570996
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A70 Depressive disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.041354675; Fold-change: 0.18656211; Z-score: 0.609002813
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Prefrontal cortex
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.517671463; Fold-change: -0.323256507; Z-score: -0.535074732
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 08 Disease of the nervous system
[+] ICD-11: 8A00 Parkinsonism		Click to Show/Hide the Full List
The Studied Tissue	Substantia nigra tissue
The Specified Disease	Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.386414325; Fold-change: 0.236374411; Z-score: 0.205749552
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A01 Choreiform disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.384110846; Fold-change: -0.002735366; Z-score: -0.002629882
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A20 Alzheimer disease		Click to Show/Hide the Full List
The Studied Tissue	Entorhinal cortex
The Specified Disease	Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.44E-05; Fold-change: 0.191146572; Z-score: 0.384857856
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A2Y Neurocognitive impairment		Click to Show/Hide the Full List
The Studied Tissue	White matter tissue
The Specified Disease	HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.012484676; Fold-change: 0.680857932; Z-score: 1.058951759
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A40 Multiple sclerosis		Click to Show/Hide the Full List
The Studied Tissue	Plasmacytoid dendritic cells
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.005046974; Fold-change: 0.809326869; Z-score: 1.163412011
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Spinal cord
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.172907104; Fold-change: 0.380191146; Z-score: 0.514717547
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: 8A60 Epilepsy		Click to Show/Hide the Full List
The Studied Tissue	Peritumoral cortex tissue
The Specified Disease	Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.070665109; Fold-change: -0.434451192; Z-score: -0.680072474
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
The Studied Tissue	Whole blood
The Specified Disease	Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.111704509; Fold-change: -0.257419147; Z-score: -0.236171817
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B01 Subarachnoid haemorrhage		Click to Show/Hide the Full List
The Studied Tissue	Intracranial artery
The Specified Disease	Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.007184947; Fold-change: 1.629240212; Z-score: 3.317972413
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B11 Cerebral ischaemic stroke		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.307787218; Fold-change: -0.003789815; Z-score: -0.013139934
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specified Disease	Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.466690942; Fold-change: 0.28600892; Z-score: 0.437232781
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B60 Motor neuron disease		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.286551437; Fold-change: 0.23360625; Z-score: 0.412232598
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.106478673; Fold-change: 0.250779623; Z-score: 0.405672379
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8C70 Muscular dystrophy		Click to Show/Hide the Full List
The Studied Tissue	Muscle tissue
The Specified Disease	Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.103444292; Fold-change: 0.39299827; Z-score: 0.750885779
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8C75 Distal myopathy		Click to Show/Hide the Full List
The Studied Tissue	Muscle tissue
The Specified Disease	Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.16E-07; Fold-change: 1.088301838; Z-score: 2.391421391
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 09 Disease of the visual system
[+] ICD-11: 9A96 Anterior uveitis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral monocyte
The Specified Disease	Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.110846367; Fold-change: -0.708335488; Z-score: -2.540397273
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 11 Disease of the circulatory system
[+] ICD-11: BA41 Myocardial infarction		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.47E-07; Fold-change: 2.876812115; Z-score: 1.40628362
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: BA80 Coronary artery disease		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.331633062; Fold-change: -0.457826941; Z-score: -0.695839038
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: BB70 Aortic valve stenosis		Click to Show/Hide the Full List
The Studied Tissue	Calcified aortic valve
The Specified Disease	Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.438629134; Fold-change: 0.247466028; Z-score: 0.404251435
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 12 Disease of the respiratory system
[+] ICD-11: 7A40 Central sleep apnoea		Click to Show/Hide the Full List
The Studied Tissue	Hyperplastic tonsil
The Specified Disease	Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.112147132; Fold-change: -0.948172162; Z-score: -0.923213573
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA08 Vasomotor or allergic rhinitis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.506173439; Fold-change: 0.061197698; Z-score: 0.07710833
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA0A Chronic rhinosinusitis		Click to Show/Hide the Full List
The Studied Tissue	Sinus mucosa tissue
The Specified Disease	Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.461542965; Fold-change: -0.35722578; Z-score: -0.490787739
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA22 Chronic obstructive pulmonary disease		Click to Show/Hide the Full List
The Studied Tissue	Small airway epithelium
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.556278698; Fold-change: -0.18977644; Z-score: -0.306824435
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Lung tissue
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.462996548; Fold-change: 0.072200149; Z-score: 0.180203367
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA23 Asthma		Click to Show/Hide the Full List
The Studied Tissue	Nasal and bronchial airway
The Specified Disease	Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001795845; Fold-change: -0.001129016; Z-score: -0.00124751
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CB03 Idiopathic interstitial pneumonitis		Click to Show/Hide the Full List
The Studied Tissue	Lung tissue
The Specified Disease	Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.033317275; Fold-change: -0.578312388; Z-score: -1.739278916
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 13 Disease of the digestive system
[+] ICD-11: DA0C Periodontal disease		Click to Show/Hide the Full List
The Studied Tissue	Gingival tissue
The Specified Disease	Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.16E-12; Fold-change: -0.331524281; Z-score: -1.188580263
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: DA42 Gastritis		Click to Show/Hide the Full List
The Studied Tissue	Gastric antrum tissue
The Specified Disease	Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.68095839; Fold-change: 0.36850981; Z-score: 0.359384498
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: DB92 Non-alcoholic fatty liver disease		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.147707203; Fold-change: 0.251994536; Z-score: 0.760664601
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: DB99 Hepatic failure		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.71E-05; Fold-change: 1.463979893; Z-score: 3.098331362
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: DD71 Ulcerative colitis		Click to Show/Hide the Full List
The Studied Tissue	Colon mucosal tissue
The Specified Disease	Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.074996583; Fold-change: 1.152716717; Z-score: 0.830861604
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
[+] ICD-11: DD91 Irritable bowel syndrome		Click to Show/Hide the Full List
The Studied Tissue	Rectal colon tissue
The Specified Disease	Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.4698901; Fold-change: 0.045030805; Z-score: 0.13256862
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 14 Disease of the skin
[+] ICD-11: EA80 Atopic eczema		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.23E-07; Fold-change: -0.491938608; Z-score: -2.433169623
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: EA90 Psoriasis		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.96E-18; Fold-change: -0.244257678; Z-score: -0.892973762
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.70E-33; Fold-change: 1.14758462; Z-score: 2.91270015
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: ED63 Acquired hypomelanotic disorder		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.277673819; Fold-change: 0.04576992; Z-score: 0.261530399
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: ED70 Alopecia or hair loss		Click to Show/Hide the Full List
The Studied Tissue	Skin from scalp
The Specified Disease	Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.082734813; Fold-change: -0.040976556; Z-score: -0.201156443
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: EK0Z Contact dermatitis		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.330176671; Fold-change: -0.076718564; Z-score: -0.713715554
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
[+] ICD-11: FA00 Osteoarthritis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.816319379; Fold-change: 0.005224648; Z-score: 0.017249772
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.747659489; Fold-change: -0.189927385; Z-score: -0.185526442
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA20 Rheumatoid arthritis		Click to Show/Hide the Full List
The Studied Tissue	Synovial tissue
The Specified Disease	Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.043128142; Fold-change: 0.828815099; Z-score: 1.172487919
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA24 Juvenile idiopathic arthritis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.077448082; Fold-change: 0.0710442; Z-score: 0.139080546
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA92 Inflammatory spondyloarthritis		Click to Show/Hide the Full List
The Studied Tissue	Pheripheral blood
The Specified Disease	Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.203150333; Fold-change: 0.184751453; Z-score: 0.725392894
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FB83 Low bone mass disorder		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.067777048; Fold-change: 0.710628136; Z-score: 0.82797533
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 16 Disease of the genitourinary system
[+] ICD-11: GA10 Endometriosis		Click to Show/Hide the Full List
The Studied Tissue	Endometrium tissue
The Specified Disease	Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.51342091; Fold-change: -0.675413879; Z-score: -0.676790858
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: GC00 Cystitis		Click to Show/Hide the Full List
The Studied Tissue	Bladder tissue
The Specified Disease	Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.015248057; Fold-change: 0.571244727; Z-score: 1.793065342
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 19 Certain condition originating in the perinatal period
[+] ICD-11: KA21 Short gestation disorder		Click to Show/Hide the Full List
The Studied Tissue	Myometrium
The Specified Disease	Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.579862634; Fold-change: -0.286684252; Z-score: -0.45937957
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 20 Developmental anomaly
[+] ICD-11: LD2C Overgrowth syndrome		Click to Show/Hide the Full List
The Studied Tissue	Adipose tissue
The Specified Disease	Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.645992065; Fold-change: 0.292033552; Z-score: 0.291502601
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome		Click to Show/Hide the Full List
The Studied Tissue	Perituberal tissue
The Specified Disease	Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.127887029; Fold-change: 0.580640964; Z-score: 2.214149293
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual