Transcription Factor (TF) Information

General Information of This TF
TF ID	TFD0052
TF name	Transcriptional activator GLI3 (GLI3)
Synonyms	GLI3; GLI3 C-terminally truncated form; GLI3 form of 190 kDa; GLI3 form of 83 kDa; GLI3 full-length protein; GLI3-190; GLI3-83; GLI3FL; Transcriptional repressor GLI3R
Gene Name	GLI3
Gene ID	2737
TF Classification	Superclass	Zinc-coordinating DNA-binding domains
	Class	C2H2 zinc finger factors
	Family	More than 3 adjacent zinc finger factors
	Subfamily	GLI-like factors
Function	This transcription factor is a transcriptional activator and a repressor of the sonic hedgehog (Shh) pathway. The full-length GLI3 form (GLI3FL) after phosphorylation and nuclear translocation, acts as an activator (GLI3A) while GLI3R, its C-terminally truncated form, acts as a repressor.
Sequence	MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITM QPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFAMDPRNGYMEP HYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHMTSALSSSPTYPDLPFIRISPHR NPTAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISATRGLSPTDAPHAGVSPAEYYHQ MALLTGQRSPYADIIPSAATAGTGAIHMEYLHAMDSTRFSSPRLSARPSRKRTLSISPLS DHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYSSAPVSLHMH QQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQNKPTSE SAVSSTGDPMHNKRSKIKPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYET NCHWEGCAREFDTQEQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRH TGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRT HSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDIHPRPPPPRDSGSHS QSRSPGRPTQGALGEQQDLSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPI SNYSNSGLELPLTDGGSIGDLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHVKL ERLKQVNGMFPRLNPILPPKAPAVSPLIGNGTQSNNTCSLGGPMTLLPGRSDLSGVDVTM LNMLNRRDSSASTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPIST DASRRSSEASQSDGLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMERMSLKTRLALL GDALEPGVALPPVHAPRRCSDGGAHGYGRRHLQPHDAPGHGVRRASDPVRTGSEGLALPR VPRFSSLSSCNPPAMATSAEKRSLVLQNYTRPEGGQSRNFHSSPCPPSITENVTLESLTM DADANLNDEDFLPDDVVQYLNSQNQAGYEQHFPSALPDDSKVPHGPGDFDAPGLPDSHAG QQFHALEQPCPEGSKTDLPIQWNEVSSGSADLSSSKLKCGPRPAVPQTRAFGFCNGMVVH PQNPLRSGPAGGYQTLGENSNPYGGPEHLMLHNSPGSGTSGNAFHEQPCKAPQYGNCLNR QPVAPGALDGACGAGIQASKLKSTPMQGSGGQLNFGLPVAPNESAGSMVNGMQNQDPVGQ GYLAHQLLGDSMQHPGAGRPGQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSSLAVV RGYQPCASFGGSRRQAMPRDSLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYS GQFYDQTVGFSQQDTKAGSFSISDASCLLQGTSAKNSELLSPGANQVTSTVDSLDSHDLE GVQIDFDAIIDDGDHSSLMSGALSPSIIQNLSHSSSRLTTPRASLPFPALSMSTTNMAIG DMSSLLTSLAEESKFLAVMQ
Uniprot ID	GLI3_HUMAN
Ensembl ID	ENSG00000106571
HGNC ID	HGNC:4319
JASPAR ID	MA1491.1
TF Binding Frequency Matrix

Drug Transporter(s) Regulated by This TF
Repression
MRP8	Transporter Info	Acute myeloid leukemia [ICD11: 2A60]	[1]

Disease-specific Protein Abundances of TF
ICD-11: 01 Certain infectious or parasitic disease
[+] ICD-11: 1C1H Necrotising ulcerative gingivitis		Click to Show/Hide the Full List
The Studied Tissue	Gingival tissue
The Specified Disease	Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.696894183; Fold-change: -0.007437896; Z-score: -0.022186206
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1E30 Influenza		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.110918882; Fold-change: 0.21289459; Z-score: 1.694288862
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1E51 Chronic viral hepatitis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.116082494; Fold-change: -0.053951167; Z-score: -0.246613638
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1G41 Sepsis with septic shock		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.026292773; Fold-change: 0.041320366; Z-score: 0.115676514
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA40 Respiratory syncytial virus infection		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.024054184; Fold-change: -0.126152973; Z-score: -0.868025973
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA42 Rhinovirus infection		Click to Show/Hide the Full List
The Studied Tissue	Nasal epithelium tissue
The Specified Disease	Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.014036348; Fold-change: 0.159872914; Z-score: 0.571427743
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: KA60 Neonatal sepsis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.980938069; Fold-change: -0.019720876; Z-score: -0.058421215
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 02 Neoplasm
[+] ICD-11: 2A00 Brain cancer		Click to Show/Hide the Full List
The Studied Tissue	Nervous tissue
The Specified Disease	Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.00E-16; Fold-change: 0.369745758; Z-score: 0.540932162
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.278293543; Fold-change: 1.108707547; Z-score: 1.666916539
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	White matter tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.113073962; Fold-change: 0.03809562; Z-score: 0.160134176
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.84E-09; Fold-change: 1.948668995; Z-score: 4.440899485
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A20 Myeloproliferative neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.915531776; Fold-change: -0.025514083; Z-score: -0.188457109
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.10E-05; Fold-change: 0.164158894; Z-score: 1.289455173
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A36 Myelodysplastic syndrome		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.037721479; Fold-change: -0.033046076; Z-score: -0.146214362
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.786499816; Fold-change: -0.199841812; Z-score: -0.532639906
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A81 Diffuse large B-cell lymphoma		Click to Show/Hide the Full List
The Studied Tissue	Tonsil tissue
The Specified Disease	Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.937485473; Fold-change: -0.000675526; Z-score: -0.003174588
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A83 Plasma cell neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.680403009; Fold-change: -0.017162929; Z-score: -0.040304795
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Bone marrow
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.054359844; Fold-change: 0.029500526; Z-score: 0.128615073
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B33 Leukaemia		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.007832483; Fold-change: 0.064435358; Z-score: 0.315787435
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B6E Oral cancer		Click to Show/Hide the Full List
The Studied Tissue	Oral tissue
The Specified Disease	Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.00E-05; Fold-change: 0.606799778; Z-score: 1.043942154
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.99764694; Fold-change: -0.061636871; Z-score: -0.131109518
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B70 Esophageal cancer		Click to Show/Hide the Full List
The Studied Tissue	Esophagus
The Specified Disease	Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.074158668; Fold-change: -0.084518156; Z-score: -0.247532037
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: 2B72 Stomach cancer		Click to Show/Hide the Full List
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.603695984; Fold-change: 0.195342594; Z-score: 0.150190299
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.175222804; Fold-change: 0.189452001; Z-score: 0.464817378
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B90 Colon cancer		Click to Show/Hide the Full List
The Studied Tissue	Colon tissue
The Specified Disease	Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.789561387; Fold-change: -0.060447701; Z-score: -0.108879837
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.003886486; Fold-change: -0.250526472; Z-score: -0.319030236
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B92 Rectal cancer		Click to Show/Hide the Full List
The Studied Tissue	Rectal colon tissue
The Specified Disease	Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.053164691; Fold-change: -0.414350633; Z-score: -1.083087459
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.059039343; Fold-change: -0.542789029; Z-score: -1.53980969
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C10 Pancreatic cancer		Click to Show/Hide the Full List
The Studied Tissue	Pancreas
The Specified Disease	Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.029352455; Fold-change: 0.223178957; Z-score: 0.441655782
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.16E-05; Fold-change: 0.765161064; Z-score: 0.973015707
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C12 Liver cancer		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.696334011; Fold-change: -0.068205342; Z-score: -0.210493141
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.007185911; Fold-change: -0.217744254; Z-score: -0.463381245
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.334567468; Fold-change: 0.047183542; Z-score: 0.203364499
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual Download TF expression data in the tissue of the other disease section
[+] ICD-11: 2C25 Lung cancer		Click to Show/Hide the Full List
The Studied Tissue	Lung tissue
The Specified Disease	Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.27E-06; Fold-change: -0.150022854; Z-score: -0.523104993
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.64E-05; Fold-change: -0.141017538; Z-score: -0.401989365
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C30 Skin cancer		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.003639356; Fold-change: 0.267399808; Z-score: 0.628311914
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Skin
The Specified Disease	Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.038062788; Fold-change: -0.128165406; Z-score: -0.277055777
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.34E-06; Fold-change: 0.451059773; Z-score: 0.898469435
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C6Z Breast cancer		Click to Show/Hide the Full List
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.32E-05; Fold-change: -0.146008734; Z-score: -0.293768339
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.135870433; Fold-change: 0.171259429; Z-score: 0.307821702
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C73 Ovarian cancer		Click to Show/Hide the Full List
The Studied Tissue	Ovarian tissue
The Specified Disease	Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.65E-06; Fold-change: -1.020027894; Z-score: -3.042930904
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.91E-05; Fold-change: -0.709409259; Z-score: -1.570110951
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C77 Cervical cancer		Click to Show/Hide the Full List
The Studied Tissue	Cervical tissue
The Specified Disease	Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.009002448; Fold-change: -0.069705455; Z-score: -0.29012364
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C78 Uterine cancer		Click to Show/Hide the Full List
The Studied Tissue	Endometrium tissue
The Specified Disease	Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.43E-13; Fold-change: -0.350111139; Z-score: -0.70558577
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.54E-08; Fold-change: -0.729773264; Z-score: -6.185429956
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C82 Prostate cancer		Click to Show/Hide the Full List
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.53E-06; Fold-change: -1.085107945; Z-score: -1.640223866
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C90 Renal cancer		Click to Show/Hide the Full List
The Studied Tissue	Kidney
The Specified Disease	Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.165033269; Fold-change: 0.505439486; Z-score: 0.717261155
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.37E-08; Fold-change: 0.401661923; Z-score: 0.803765434
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C92 Ureter cancer		Click to Show/Hide the Full List
The Studied Tissue	Urothelium
The Specified Disease	Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.017415108; Fold-change: 0.177187302; Z-score: 0.647021252
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C94 Bladder cancer		Click to Show/Hide the Full List
The Studied Tissue	Bladder tissue
The Specified Disease	Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000170715; Fold-change: -0.523701483; Z-score: -2.303515918
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D02 Retinal cancer		Click to Show/Hide the Full List
The Studied Tissue	Uvea
The Specified Disease	Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.91E-05; Fold-change: 1.039646701; Z-score: 2.717094964
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D10 Thyroid cancer		Click to Show/Hide the Full List
The Studied Tissue	Thyroid
The Specified Disease	Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.33E-10; Fold-change: -0.425123595; Z-score: -1.224350514
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.213919345; Fold-change: -0.071639538; Z-score: -0.256368825
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D11 Adrenal cancer		Click to Show/Hide the Full List
The Studied Tissue	Adrenal cortex
The Specified Disease	Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.681495518; Fold-change: -0.250042248; Z-score: -0.480868671
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
[+] ICD-11: 2D12 Endocrine gland neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.006791081; Fold-change: -0.488502558; Z-score: -0.981145616
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000570375; Fold-change: -0.762797561; Z-score: -1.74822589
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D42 Head and neck cancer		Click to Show/Hide the Full List
The Studied Tissue	Head and neck tissue
The Specified Disease	Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.92E-14; Fold-change: 0.390609222; Z-score: 1.158934473
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 03 Disease of the blood or blood-forming organs
[+] ICD-11: 3A51 Sickle cell disorder		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.925513336; Fold-change: -0.051421405; Z-score: -0.231095766
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3A70 Aplastic anaemia		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.092427675; Fold-change: 0.170666294; Z-score: 0.451777089
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3B63 Thrombocytosis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.229101251; Fold-change: 0.071068981; Z-score: 0.601696209
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3B64 Thrombocytopenia		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.711102858; Fold-change: -0.319345248; Z-score: -0.679825815
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 04 Disease of the immune system
[+] ICD-11: 4A00 Immunodeficiency		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.705817239; Fold-change: -0.071898691; Z-score: -0.777242116
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A40 Lupus erythematosus		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.273107119; Fold-change: 0.056020993; Z-score: 0.17920985
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A42 Systemic sclerosis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.217607959; Fold-change: 0.101806983; Z-score: 0.547740814
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A43 Systemic autoimmune disease		Click to Show/Hide the Full List
The Studied Tissue	Salivary gland tissue
The Specified Disease	Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.079543203; Fold-change: 0.5215982; Z-score: 1.533760684
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.498085543; Fold-change: -0.262241701; Z-score: -0.793652328
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A62 Behcet disease		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.710097731; Fold-change: -0.049642533; Z-score: -0.220622777
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4B04 Monocyte count disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.561030881; Fold-change: 0.078501671; Z-score: 0.445844612
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 05 Endocrine, nutritional or metabolic disease
[+] ICD-11: 5A11 Type 2 diabetes mellitus		Click to Show/Hide the Full List
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.030007202; Fold-change: -0.383665789; Z-score: -1.406018794
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.205245896; Fold-change: -0.12692602; Z-score: -0.530479011
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Liver tissue
The Specified Disease	Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001958468; Fold-change: 0.19789413; Z-score: 2.202888015
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5A80 Ovarian dysfunction		Click to Show/Hide the Full List
The Studied Tissue	Vastus lateralis muscle
The Specified Disease	Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.570843259; Fold-change: -0.0241396; Z-score: -0.125876408
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder		Click to Show/Hide the Full List
The Studied Tissue	Biceps muscle
The Specified Disease	Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.006864063; Fold-change: 0.287886548; Z-score: 2.0774149
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C56 Lysosomal disease		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.120850227; Fold-change: 0.172954853; Z-score: 1.288659553
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C80 Hyperlipoproteinaemia		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.396813151; Fold-change: 0.063648361; Z-score: 0.344579811
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.016035392; Fold-change: -0.14098684; Z-score: -0.489678485
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
[+] ICD-11: 6A02 Autism spectrum disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.686479227; Fold-change: -0.066853439; Z-score: -0.345882783
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A20 Schizophrenia		Click to Show/Hide the Full List
The Studied Tissue	Prefrontal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.654771881; Fold-change: -0.10696494; Z-score: -0.157351743
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Superior temporal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.840234668; Fold-change: 0.067619904; Z-score: 0.199624018
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A60 Bipolar disorder		Click to Show/Hide the Full List
The Studied Tissue	Prefrontal cortex
The Specified Disease	Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.04086971; Fold-change: 0.152518067; Z-score: 0.376944554
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A70 Depressive disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.360506893; Fold-change: 0.012380265; Z-score: 0.05063466
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Prefrontal cortex
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.29757814; Fold-change: -0.079651877; Z-score: -0.198235626
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 08 Disease of the nervous system
[+] ICD-11: 8A00 Parkinsonism		Click to Show/Hide the Full List
The Studied Tissue	Substantia nigra tissue
The Specified Disease	Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.989395762; Fold-change: 0.371042483; Z-score: 0.683294293
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A01 Choreiform disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.254907229; Fold-change: -0.103434109; Z-score: -0.555357877
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A20 Alzheimer disease		Click to Show/Hide the Full List
The Studied Tissue	Entorhinal cortex
The Specified Disease	Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.36E-05; Fold-change: 0.325260213; Z-score: 0.523622126
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A2Y Neurocognitive impairment		Click to Show/Hide the Full List
The Studied Tissue	White matter tissue
The Specified Disease	HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.143668095; Fold-change: 0.082307399; Z-score: 0.336150917
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A40 Multiple sclerosis		Click to Show/Hide the Full List
The Studied Tissue	Plasmacytoid dendritic cells
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.124279526; Fold-change: 0.190107985; Z-score: 0.542382942
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Spinal cord
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.237551868; Fold-change: 0.227288511; Z-score: 1.180805426
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: 8A60 Epilepsy		Click to Show/Hide the Full List
The Studied Tissue	Peritumoral cortex tissue
The Specified Disease	Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.561698518; Fold-change: 0.00568475; Z-score: 0.021865273
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
The Studied Tissue	Whole blood
The Specified Disease	Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.946294124; Fold-change: 0.043448575; Z-score: 0.192043816
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B01 Subarachnoid haemorrhage		Click to Show/Hide the Full List
The Studied Tissue	Intracranial artery
The Specified Disease	Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.52187425; Fold-change: 0.019521687; Z-score: 0.055111322
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B11 Cerebral ischaemic stroke		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.011082717; Fold-change: -0.232493286; Z-score: -0.785953376
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specified Disease	Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.257901747; Fold-change: -0.03402704; Z-score: -0.150614855
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B60 Motor neuron disease		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.682179591; Fold-change: -0.081882064; Z-score: -0.289227162
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.457360386; Fold-change: -0.086099235; Z-score: -0.167907816
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8C70 Muscular dystrophy		Click to Show/Hide the Full List
The Studied Tissue	Muscle tissue
The Specified Disease	Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.006634502; Fold-change: 0.597115927; Z-score: 1.714492719
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8C75 Distal myopathy		Click to Show/Hide the Full List
The Studied Tissue	Muscle tissue
The Specified Disease	Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.23E-09; Fold-change: 1.742102536; Z-score: 3.511003576
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 09 Disease of the visual system
[+] ICD-11: 9A96 Anterior uveitis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral monocyte
The Specified Disease	Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.50325098; Fold-change: -0.063264295; Z-score: -0.299958539
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 11 Disease of the circulatory system
[+] ICD-11: BA41 Myocardial infarction		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.132320157; Fold-change: 0.078112958; Z-score: 0.200508316
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: BA80 Coronary artery disease		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.243178664; Fold-change: -0.327320986; Z-score: -0.49673132
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: BB70 Aortic valve stenosis		Click to Show/Hide the Full List
The Studied Tissue	Calcified aortic valve
The Specified Disease	Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.303111467; Fold-change: 0.320654403; Z-score: 0.621977343
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 12 Disease of the respiratory system
[+] ICD-11: 7A40 Central sleep apnoea		Click to Show/Hide the Full List
The Studied Tissue	Hyperplastic tonsil
The Specified Disease	Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000915193; Fold-change: -0.991712298; Z-score: -2.263438508
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA08 Vasomotor or allergic rhinitis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.452576669; Fold-change: 0.01659239; Z-score: 0.083645291
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA0A Chronic rhinosinusitis		Click to Show/Hide the Full List
The Studied Tissue	Sinus mucosa tissue
The Specified Disease	Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.011462486; Fold-change: -0.427525075; Z-score: -2.186575994
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA22 Chronic obstructive pulmonary disease		Click to Show/Hide the Full List
The Studied Tissue	Small airway epithelium
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.39E-07; Fold-change: -0.501748519; Z-score: -1.011031481
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Lung tissue
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.828313478; Fold-change: -0.026519346; Z-score: -0.07827369
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA23 Asthma		Click to Show/Hide the Full List
The Studied Tissue	Nasal and bronchial airway
The Specified Disease	Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000742185; Fold-change: -0.247904754; Z-score: -0.360034256
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CB03 Idiopathic interstitial pneumonitis		Click to Show/Hide the Full List
The Studied Tissue	Lung tissue
The Specified Disease	Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.165873106; Fold-change: 0.421804117; Z-score: 1.172951866
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 13 Disease of the digestive system
[+] ICD-11: DA0C Periodontal disease		Click to Show/Hide the Full List
The Studied Tissue	Gingival tissue
The Specified Disease	Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.409094458; Fold-change: 0.024172612; Z-score: 0.079255734
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: DA42 Gastritis		Click to Show/Hide the Full List
The Studied Tissue	Gastric antrum tissue
The Specified Disease	Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.646987659; Fold-change: 0.268100215; Z-score: 0.460124002
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: DB92 Non-alcoholic fatty liver disease		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.817060485; Fold-change: -0.018707347; Z-score: -0.144399339
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: DB99 Hepatic failure		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.048391637; Fold-change: 0.609309316; Z-score: 1.027944719
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: DD71 Ulcerative colitis		Click to Show/Hide the Full List
The Studied Tissue	Colon mucosal tissue
The Specified Disease	Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.066396401; Fold-change: 0.160543727; Z-score: 0.41315609
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
[+] ICD-11: DD91 Irritable bowel syndrome		Click to Show/Hide the Full List
The Studied Tissue	Rectal colon tissue
The Specified Disease	Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.196742079; Fold-change: -0.040278943; Z-score: -0.152810247
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 14 Disease of the skin
[+] ICD-11: EA80 Atopic eczema		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.026905206; Fold-change: -0.125546727; Z-score: -0.694555274
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: EA90 Psoriasis		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.94E-10; Fold-change: -0.346641801; Z-score: -0.940422467
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.12E-11; Fold-change: 0.372517518; Z-score: 1.135308476
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: ED63 Acquired hypomelanotic disorder		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.033840752; Fold-change: -0.267045772; Z-score: -1.185585217
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: ED70 Alopecia or hair loss		Click to Show/Hide the Full List
The Studied Tissue	Skin from scalp
The Specified Disease	Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.823151955; Fold-change: -0.041207017; Z-score: -0.140420336
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: EK0Z Contact dermatitis		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.424238578; Fold-change: -0.093202301; Z-score: -0.806355505
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
[+] ICD-11: FA00 Osteoarthritis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.050551076; Fold-change: 0.04882514; Z-score: 0.34749242
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.745406152; Fold-change: -0.232081257; Z-score: -0.450673294
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA20 Rheumatoid arthritis		Click to Show/Hide the Full List
The Studied Tissue	Synovial tissue
The Specified Disease	Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.006592421; Fold-change: 0.639734684; Z-score: 1.320490806
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA24 Juvenile idiopathic arthritis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.72755301; Fold-change: -0.015089797; Z-score: -0.051547089
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA92 Inflammatory spondyloarthritis		Click to Show/Hide the Full List
The Studied Tissue	Pheripheral blood
The Specified Disease	Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.259125999; Fold-change: -0.046850579; Z-score: -0.357099278
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FB83 Low bone mass disorder		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.169395634; Fold-change: 0.251483784; Z-score: 0.917183604
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 16 Disease of the genitourinary system
[+] ICD-11: GA10 Endometriosis		Click to Show/Hide the Full List
The Studied Tissue	Endometrium tissue
The Specified Disease	Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.658133058; Fold-change: -0.229363605; Z-score: -0.637257019
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: GC00 Cystitis		Click to Show/Hide the Full List
The Studied Tissue	Bladder tissue
The Specified Disease	Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.545645483; Fold-change: -0.173315199; Z-score: -1.046307946
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 19 Certain condition originating in the perinatal period
[+] ICD-11: KA21 Short gestation disorder		Click to Show/Hide the Full List
The Studied Tissue	Myometrium
The Specified Disease	Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.458258915; Fold-change: 0.045103762; Z-score: 0.188423674
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 20 Developmental anomaly
[+] ICD-11: LD2C Overgrowth syndrome		Click to Show/Hide the Full List
The Studied Tissue	Adipose tissue
The Specified Disease	Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.779856935; Fold-change: -0.070076762; Z-score: -0.255927969
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome		Click to Show/Hide the Full List
The Studied Tissue	Perituberal tissue
The Specified Disease	Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.071372566; Fold-change: 0.517079523; Z-score: 1.279672052
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual