Transcription Factor (TF) Information

General Information of This TF
TF ID
TFD0081
TF name
Lymphoid enhancer-binding factor 1 (LEF1)
Synonyms
LEF-1; LEF1; T cell-specific transcription factor 1-alpha; TCF1-alpha
Gene Name
LEF1
Gene ID
51176
TF Classification Superclass Other all-alpha-helical DNA-binding domains
Class High-mobility group domain factors
Family TCF-7-related factors
Subfamily Other factors
Function This transcription factor activates transcription of target genes in the presence of CTNNB1 and EP300. PIAG antagonizes both Wnt-dependent and Wnt-independent activation by LEF1. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by LEF1 and CTNNB1. Isoform 1 transcriptionally activates MYC and CCND1 expression and enhances proliferation of pancreatic tumor cells.
Sequence
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMS
RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM
QLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI
Uniprot ID
LEF1_HUMAN
Ensembl ID
ENSG00000138795
HGNC ID
HGNC:6551
JASPAR ID
MA0768.1
TF Binding Frequency Matrix TFD0081
Drug Transporter(s) Regulated by This TF

Activation

CACNA1G

 Transporter Info

Heallth [ICD11: N.A]

 [1]
Disease-specific Protein Abundances of TF
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.109952211; Fold-change: 0.054489487; Z-score: 0.188837965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002659128; Fold-change: 0.531158413; Z-score: 5.237844731
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.453149675; Fold-change: 0.247924516; Z-score: 0.452082122
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.42E-29; Fold-change: -1.185804688; Z-score: -1.258134277
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001126505; Fold-change: -0.744002816; Z-score: -1.592695249
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.947030098; Fold-change: 0.005829032; Z-score: 0.016774742
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.13E-12; Fold-change: -1.065256994; Z-score: -1.18021666
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.04E-14; Fold-change: -0.158103185; Z-score: -0.516159203
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.908236842; Fold-change: -0.058499779; Z-score: -0.453766643
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002296132; Fold-change: -0.609367016; Z-score: -1.302100159
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.004475776; Fold-change: 0.094834221; Z-score: 0.562319715
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000156476; Fold-change: -0.201256858; Z-score: -0.77958628
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002230929; Fold-change: -0.07129933; Z-score: -0.333026298
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001246796; Fold-change: -0.15603262; Z-score: -0.644375052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.068407581; Fold-change: -1.553396366; Z-score: -1.465773785
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.432140156; Fold-change: 0.05521588; Z-score: 0.237630774
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.946900645; Fold-change: -0.004949493; Z-score: -0.022223917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.007472788; Fold-change: -0.775705041; Z-score: -1.698007936
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.013049368; Fold-change: -0.04417072; Z-score: -0.109105743
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.68E-05; Fold-change: -0.479889018; Z-score: -1.097138286
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.071314722; Fold-change: 0.074853954; Z-score: 0.222001022
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.063967331; Fold-change: 0.304558038; Z-score: 1.376080287
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.971795757; Fold-change: -0.015281001; Z-score: -0.057351775
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.001310316; Fold-change: -0.231310536; Z-score: -0.962987792
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.69262503; Fold-change: -0.062927656; Z-score: -0.201749277
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.00018568; Fold-change: 0.059907553; Z-score: 0.247127899
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.011996976; Fold-change: 0.235360319; Z-score: 1.237928341
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.649620139; Fold-change: 0.030938792; Z-score: 0.102698631
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.933842862; Fold-change: -0.027717651; Z-score: -0.072005948
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 6.31E-06; Fold-change: 0.254826623; Z-score: 0.494866132
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.005867311; Fold-change: 0.089209333; Z-score: 0.363403971
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.36967924; Fold-change: -0.020212469; Z-score: -0.082521537
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.565412176; Fold-change: -0.151743546; Z-score: -0.697936538
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
Download TF expression data in the tissue of the other disease section
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.32E-09; Fold-change: 0.13647023; Z-score: 0.512968521
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.47E-08; Fold-change: 0.111893613; Z-score: 0.511851736
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.23E-08; Fold-change: 1.339111136; Z-score: 1.872688606
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.75E-70; Fold-change: 1.377790807; Z-score: 3.271931977
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 7.79E-82; Fold-change: 1.610304624; Z-score: 3.579086431
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.18E-06; Fold-change: 0.10067637; Z-score: 0.267116845
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.18E-05; Fold-change: 0.157309712; Z-score: 0.477220977
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.285819837; Fold-change: -0.022608349; Z-score: -0.078870109
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000151389; Fold-change: 0.277572371; Z-score: 0.836620974
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.022313848; Fold-change: 0.184288351; Z-score: 0.733063811
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000939063; Fold-change: -0.215897537; Z-score: -0.355434539
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.433886053; Fold-change: -0.112713046; Z-score: -0.368369695
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.958155672; Fold-change: -0.175501558; Z-score: -0.422785332
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.009434568; Fold-change: -0.319368128; Z-score: -1.112800826
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.93E-07; Fold-change: -0.209560637; Z-score: -0.936161378
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.930675463; Fold-change: 0.027877935; Z-score: 0.09402627
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.180116759; Fold-change: 0.017828888; Z-score: 0.155467812
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.011599241; Fold-change: 0.216612299; Z-score: 2.969691394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.233206112; Fold-change: 0.217250709; Z-score: 0.327961913
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.18E-08; Fold-change: 0.392847757; Z-score: 1.274687868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.142400163; Fold-change: 0.030320281; Z-score: 0.118307893
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of the other disease section
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.40328557; Fold-change: 0.080833259; Z-score: 0.198116237
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.973138282; Fold-change: 0.099492781; Z-score: 0.287694519
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.08E-09; Fold-change: 0.191630152; Z-score: 0.820257174
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.848425833; Fold-change: 0.022639209; Z-score: 0.073353216
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.278836612; Fold-change: -0.761197377; Z-score: -0.727291575
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.14E-05; Fold-change: -0.145796279; Z-score: -0.626090017
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.804955221; Fold-change: 0.047524055; Z-score: 0.051776556
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.670129272; Fold-change: -0.233726513; Z-score: -0.553333233
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003765096; Fold-change: -0.239140396; Z-score: -0.248851367
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.392394648; Fold-change: -0.169535714; Z-score: -0.415759256
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.165071926; Fold-change: -0.193927528; Z-score: -1.696570264
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.407110272; Fold-change: -0.017004774; Z-score: -0.180165901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.734958374; Fold-change: 0.574914063; Z-score: 0.803129227
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.062479733; Fold-change: -0.191352286; Z-score: -1.083329056
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.758524927; Fold-change: 0.064208892; Z-score: 0.361722419
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.207848507; Fold-change: 0.038633767; Z-score: 0.257405115
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.106800208; Fold-change: 0.161585678; Z-score: 1.571158853
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.226423731; Fold-change: 0.046546579; Z-score: 0.215908226
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.012357962; Fold-change: -0.149534516; Z-score: -1.93057803
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.238029238; Fold-change: -0.149621621; Z-score: -0.300022519
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.859342775; Fold-change: 0.033908913; Z-score: 0.070384072
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.42E-05; Fold-change: -1.652186167; Z-score: -1.960411383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.13392743; Fold-change: -0.083711144; Z-score: -0.085354789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.127964767; Fold-change: 0.015161046; Z-score: 0.015460345
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.849769995; Fold-change: -0.045512098; Z-score: -0.176422178
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.546474813; Fold-change: 0.010381503; Z-score: 0.063545666
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.272939457; Fold-change: -0.233120715; Z-score: -0.420268697
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.906759503; Fold-change: 0.00735692; Z-score: 0.044820043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.759282579; Fold-change: 0.016748265; Z-score: 0.046597723
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.970762466; Fold-change: -0.054444443; Z-score: -0.058967604
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.063851689; Fold-change: 0.036684619; Z-score: 0.145588428
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.054447399; Fold-change: -0.09336128; Z-score: -0.474786285
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.987919402; Fold-change: -0.204359516; Z-score: -0.371900791
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.948421003; Fold-change: -0.056815531; Z-score: -0.057417113
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.195789091; Fold-change: -0.375180763; Z-score: -2.710968959
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of the other disease section
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.705452018; Fold-change: -0.308507191; Z-score: -0.30341049
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.989785131; Fold-change: -0.002057804; Z-score: -0.015562047
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.63E-08; Fold-change: -0.973524165; Z-score: -1.847786492
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.252205925; Fold-change: -0.598539391; Z-score: -0.844408288
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.034729158; Fold-change: 0.242771024; Z-score: 1.739456187
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.234716675; Fold-change: 0.176155945; Z-score: 0.557144966
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.172736072; Fold-change: -0.172058963; Z-score: -1.04147223
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.04107049; Fold-change: 0.114351969; Z-score: 0.434021969
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 09 Disease of the visual system
             [+] ICD-11: 9A96 Anterior uveitis Click to Show/Hide the Full List
The Studied Tissue Peripheral monocyte
The Specified Disease Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.141664728; Fold-change: 0.534695578; Z-score: 1.139704755
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 11 Disease of the circulatory system
             [+] ICD-11: BA41 Myocardial infarction Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.395939032; Fold-change: -0.330567035; Z-score: -0.355126995
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: BA80 Coronary artery disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.344363634; Fold-change: -0.259907851; Z-score: -0.717854644
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: BB70 Aortic valve stenosis Click to Show/Hide the Full List
The Studied Tissue Calcified aortic valve
The Specified Disease Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.391033141; Fold-change: 0.086541792; Z-score: 0.149892158
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.896049107; Fold-change: -0.160578668; Z-score: -0.616135062
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.971857694; Fold-change: -0.166534638; Z-score: -0.439777903
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.149702409; Fold-change: 0.075866665; Z-score: 0.771463251
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00036466; Fold-change: 0.271441587; Z-score: 0.898784199
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.482769128; Fold-change: -0.032774075; Z-score: -0.102345749
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.09E-06; Fold-change: -0.169403772; Z-score: -0.493249268
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001483676; Fold-change: 0.161382261; Z-score: 2.82805165
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.005255147; Fold-change: 0.112174499; Z-score: 0.393699979
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.130373771; Fold-change: 0.24308302; Z-score: 0.873555809
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.053885026; Fold-change: 0.149330755; Z-score: 1.282663176
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.421219873; Fold-change: -0.00612237; Z-score: -0.037513575
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.006896418; Fold-change: 0.186533733; Z-score: 0.469591109
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of the other disease section
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.708936829; Fold-change: 0.021146378; Z-score: 0.078199235
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.722252485; Fold-change: -4.99E-05; Z-score: -0.000430617
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.304515849; Fold-change: 0.044187915; Z-score: 0.138852337
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 7.04E-12; Fold-change: 0.239104399; Z-score: 0.901451096
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.004949671; Fold-change: -0.114531838; Z-score: -0.925981187
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.79E-07; Fold-change: -0.762393651; Z-score: -1.036299661
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.652460699; Fold-change: -0.046141505; Z-score: -0.2522087
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.171377115; Fold-change: -0.174421828; Z-score: -0.284556071
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.08552301; Fold-change: -0.235868981; Z-score: -0.689049901
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.076470152; Fold-change: -0.315072834; Z-score: -0.711914094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.210701181; Fold-change: -0.036344144; Z-score: -0.056121475
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.062000398; Fold-change: -0.736167394; Z-score: -1.853041741
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.615471073; Fold-change: 0.089813173; Z-score: 0.292679609
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 16 Disease of the genitourinary system
             [+] ICD-11: GA10 Endometriosis Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.018045553; Fold-change: -0.416519082; Z-score: -0.553419536
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: GC00 Cystitis Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.012360373; Fold-change: 0.157179701; Z-score: 1.961906691
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 19 Certain condition originating in the perinatal period
             [+] ICD-11: KA21 Short gestation disorder Click to Show/Hide the Full List
The Studied Tissue Myometrium
The Specified Disease Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.741588172; Fold-change: -0.04089623; Z-score: -0.46937921
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 20 Developmental anomaly
             [+] ICD-11: LD2C Overgrowth syndrome Click to Show/Hide the Full List
The Studied Tissue Adipose tissue
The Specified Disease Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.686304486; Fold-change: -0.004965791; Z-score: -0.050168695
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Perituberal tissue
The Specified Disease Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.02781391; Fold-change: 0.180075173; Z-score: 1.500251599
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
References
1 LEF1/beta-catenin complex regulates transcription of the Cav3.1 calcium channel gene (Cacna1g) in thalamic neurons of the adult brain. J Neurosci. 2010 Apr 7;30(14):4957-69.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.