Transcription Factor (TF) Information

General Information of This TF
TF ID
TFD0101
TF name
Nuclear factor erythroid 2-related factor 3 (NFE2L3)
Synonyms
NF-E2-related factor 3; NFE2-related factor 3; NFE2L3; NRF3; Nuclear factor, erythroid derived 2, like 3
Gene Name
NFE2L3
Gene ID
9603
TF Classification Superclass Basic domains
Class Basic leucine zipper factors
Family Jun-related factors
Subfamily NF-E2-like factors
Function This transcription factor activates erythroid-specific, globin gene expression.
Sequence
MKHLKRWWSAGGGLLHLTLLLSLAGLRVDLDLYLLLPPPTLLQDELLFLGGPASSAYALS
PFSASGGWGRAGHLHPKGRELDPAAPPEGQLLREVRALGVPFVPRTSVDAWLVHSVAAGS
ADEAHGLLGAAAASSTGGAGASVDGGSQAVQGGGGDPRAARSGPLDAGEEEKAPAEPTAQ
VPDAGGCASEENGVLREKHEAVDHSSQHEENEERVSAQKENSLQQNDDDENKIAEKPDWE
AEKTTESRNERHLNGTDTSFSLEDLFQLLSSQPENSLEGISLGDIPLPGSISDGMNSSAH
YHVNFSQAISQDVNLHEAILLCPNNTFRRDPTARTSQSQEPFLQLNSHTTNPEQTLPGTN
LTGFLSPVDNHMRNLTSQDLLYDLDINIFDEINLMSLATEDNFDPIDVSQLFDEPDSDSG
LSLDSSHNNTSVIKSNSSHSVCDEGAIGYCTDHESSSHHDLEGAVGGYYPEPSKLCHLDQ
SDSDFHGDLTFQHVFHNHTYHLQPTAPESTSEPFPWPGKSQKIRSRYLEDTDRNLSRDEQ
RAKALHIPFSVDEIVGMPVDSFNSMLSRYYLTDLQVSLIRDIRRRGKNKVAAQNCRKRKL
DIILNLEDDVCNLQAKKETLKREQAQCNKAINIMKQKLHDLYHDIFSRLRDDQGRPVNPN
HYALQCTHDGSILIVPKELVASGHKKETQKGKRK
Uniprot ID
NF2L3_HUMAN
Ensembl ID
ENSG00000050344
HGNC ID
HGNC:7783
Drug Transporter(s) Regulated by This TF

Activation

SLC38A9

 Transporter Info

Colon cancer [ICD11: 2B90]

 [1]
Disease-specific Protein Abundances of TF
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.062962485; Fold-change: -0.052370255; Z-score: -0.138583389
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.918153775; Fold-change: -0.107380544; Z-score: -0.062723159
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.94492788; Fold-change: -0.018574976; Z-score: -0.053023016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.54E-16; Fold-change: -0.223895202; Z-score: -0.652087543
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.672017588; Fold-change: -0.033376025; Z-score: -0.104684408
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.098194892; Fold-change: 0.15872987; Z-score: 0.331576125
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.014434759; Fold-change: -0.129409474; Z-score: -0.418239714
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.83E-53; Fold-change: 0.346947798; Z-score: 0.735311562
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000175118; Fold-change: 0.311156004; Z-score: 6.10623568
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.164725918; Fold-change: 0.369213533; Z-score: 0.662994861
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.58E-19; Fold-change: 1.141519584; Z-score: 6.850221794
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.053072915; Fold-change: -0.050882398; Z-score: -0.225260579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.651674996; Fold-change: 0.06301778; Z-score: 0.273944078
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.16E-05; Fold-change: 0.278844818; Z-score: 0.603782144
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.029757921; Fold-change: 0.952164121; Z-score: 2.087405159
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.019379395; Fold-change: 0.321024908; Z-score: 0.629741518
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.679714509; Fold-change: -0.265042805; Z-score: -0.145564128
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.005775597; Fold-change: 0.375804129; Z-score: 1.129321067
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.30E-14; Fold-change: 0.106027477; Z-score: 0.433924057
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.63E-16; Fold-change: 1.130231616; Z-score: 2.62417476
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.09E-16; Fold-change: 0.509670829; Z-score: 1.035967048
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.032106567; Fold-change: 0.853220454; Z-score: 1.114344007
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.150973644; Fold-change: 1.722921053; Z-score: 1.265051139
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.00022209; Fold-change: 0.900483612; Z-score: 1.417829324
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.34E-117; Fold-change: 2.449359544; Z-score: 4.169740588
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.70E-73; Fold-change: 2.351186349; Z-score: 3.221136763
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.30E-09; Fold-change: 2.236853637; Z-score: 8.876791675
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.50E-08; Fold-change: 2.550049948; Z-score: 8.45137111
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.96E-07; Fold-change: 1.329841129; Z-score: 1.867669428
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.74E-20; Fold-change: 1.702620875; Z-score: 2.119133521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.65E-35; Fold-change: 0.486968991; Z-score: 2.992554857
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.58E-17; Fold-change: 0.248825078; Z-score: 0.714266801
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.001169123; Fold-change: 0.17551391; Z-score: 1.185859393
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
Download TF expression data in the tissue of the other disease section
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.28E-58; Fold-change: 0.780434535; Z-score: 1.599920035
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 4.75E-44; Fold-change: 0.835874992; Z-score: 1.847175686
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.538629343; Fold-change: 0.112356385; Z-score: 0.071985045
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.022667815; Fold-change: 0.263318864; Z-score: 0.40641077
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.010185019; Fold-change: -0.322800583; Z-score: -0.388629942
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.40E-86; Fold-change: 0.665018971; Z-score: 1.685986302
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.33E-14; Fold-change: 0.538658496; Z-score: 1.154616675
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.11E-08; Fold-change: 1.775631709; Z-score: 5.828777288
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.706724917; Fold-change: 0.262189193; Z-score: 0.275275287
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.80E-05; Fold-change: 0.934063566; Z-score: 1.995724816
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.22E-55; Fold-change: 1.28104243; Z-score: 2.712505221
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.367898653; Fold-change: 0.458378121; Z-score: 0.445393861
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001262474; Fold-change: 1.536730189; Z-score: 1.379785128
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.08E-07; Fold-change: 1.669132781; Z-score: 3.270438325
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 7.98E-56; Fold-change: 1.535800831; Z-score: 3.714637023
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.488747611; Fold-change: -0.058156206; Z-score: -0.61966768
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.01243773; Fold-change: 0.593104914; Z-score: 1.073766377
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002539148; Fold-change: 0.699841297; Z-score: 7.440668761
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.69E-44; Fold-change: 2.803025701; Z-score: 2.904003426
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.76E-27; Fold-change: 2.707236198; Z-score: 3.727916376
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.274664287; Fold-change: -0.026832527; Z-score: -0.439819902
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of the other disease section
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.318830791; Fold-change: -0.063770774; Z-score: -0.378653134
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003963062; Fold-change: -0.204391782; Z-score: -1.116323934
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.28E-05; Fold-change: 0.327765009; Z-score: 0.587352429
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.308385948; Fold-change: -0.128223957; Z-score: -1.126771863
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.354571108; Fold-change: -0.061703754; Z-score: -0.150371181
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.687614751; Fold-change: 0.063912532; Z-score: 0.282264934
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.414215385; Fold-change: -0.148814353; Z-score: -0.20350517
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.011697071; Fold-change: 0.440012031; Z-score: 1.420029836
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.156204324; Fold-change: 0.255923969; Z-score: 0.257586231
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.609206983; Fold-change: -0.105802384; Z-score: -0.369581587
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.085554238; Fold-change: 0.315352684; Z-score: 0.992531164
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 6.11E-06; Fold-change: 0.492475615; Z-score: 6.032014654
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.420964583; Fold-change: -0.130904793; Z-score: -0.224311864
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.089525559; Fold-change: -0.07377105; Z-score: -0.799204302
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.352454238; Fold-change: -0.023643434; Z-score: -0.069684531
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.020664047; Fold-change: 0.252353717; Z-score: 0.800165314
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.673773174; Fold-change: -0.025458211; Z-score: -0.706935167
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.82976266; Fold-change: -0.011640098; Z-score: -0.235459666
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.268125368; Fold-change: 0.173670938; Z-score: 0.460194596
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.769279423; Fold-change: 0.112852433; Z-score: 0.293602373
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.478115619; Fold-change: -0.094211102; Z-score: -0.526305952
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001561782; Fold-change: 0.891644399; Z-score: 1.469632995
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.149616355; Fold-change: 0.110973145; Z-score: 0.355830316
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.038537598; Fold-change: 0.073380872; Z-score: 0.096479886
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.357093221; Fold-change: -0.037652905; Z-score: -0.684178912
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.929214923; Fold-change: 0.023062935; Z-score: 0.130389144
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.914626292; Fold-change: 0.024439678; Z-score: 0.047800079
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.366615349; Fold-change: 0.052716345; Z-score: 0.302883849
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.186943362; Fold-change: -0.040515329; Z-score: -0.292919352
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.168993372; Fold-change: -0.101992846; Z-score: -0.667313505
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.475411231; Fold-change: 0.008752642; Z-score: 0.060030731
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.424944445; Fold-change: -0.058138409; Z-score: -0.327686818
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.008342918; Fold-change: 0.382073135; Z-score: 1.357252674
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.265039391; Fold-change: -0.191353929; Z-score: -0.260338509
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.843508375; Fold-change: 0.105589677; Z-score: 0.44942773
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of the other disease section
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.196733838; Fold-change: 0.095595288; Z-score: 0.334589603
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000702429; Fold-change: 0.716922869; Z-score: 2.936350807
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000839151; Fold-change: -0.296964811; Z-score: -0.899366155
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.724545788; Fold-change: -0.051689857; Z-score: -0.122685415
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.132497199; Fold-change: 0.029869075; Z-score: 0.870161712
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.889241321; Fold-change: 0.06381985; Z-score: 0.298308945
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.38E-05; Fold-change: 0.471467711; Z-score: 4.389917195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001103444; Fold-change: 0.202710768; Z-score: 1.138664829
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 09 Disease of the visual system
             [+] ICD-11: 9A96 Anterior uveitis Click to Show/Hide the Full List
The Studied Tissue Peripheral monocyte
The Specified Disease Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.456524671; Fold-change: 0.37620775; Z-score: 0.825055946
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 11 Disease of the circulatory system
             [+] ICD-11: BA41 Myocardial infarction Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00028557; Fold-change: -0.885746545; Z-score: -0.875097867
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: BA80 Coronary artery disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.024392789; Fold-change: 0.640008641; Z-score: 2.086334722
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: BB70 Aortic valve stenosis Click to Show/Hide the Full List
The Studied Tissue Calcified aortic valve
The Specified Disease Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.511625704; Fold-change: 0.136585003; Z-score: 0.444276953
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.540643391; Fold-change: 0.290650856; Z-score: 1.052495633
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.332513735; Fold-change: -0.065041394; Z-score: -0.20941261
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.006932936; Fold-change: 1.318404541; Z-score: 6.743910624
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000832357; Fold-change: -0.240472036; Z-score: -0.427915904
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.998905801; Fold-change: 0.035824589; Z-score: 0.119726263
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.04703048; Fold-change: 0.213039358; Z-score: 0.190750688
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00324532; Fold-change: 0.511905103; Z-score: 1.968239989
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.021398699; Fold-change: -0.068583345; Z-score: -0.173101427
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.572634061; Fold-change: -0.362417578; Z-score: -0.593813376
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.306378711; Fold-change: 0.042677376; Z-score: 0.550426187
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000274774; Fold-change: 0.891349134; Z-score: 8.538245215
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.657207284; Fold-change: -0.029136686; Z-score: -0.034701978
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of the other disease section
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.028882534; Fold-change: 0.101346421; Z-score: 0.344369596
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.01029161; Fold-change: -0.431350629; Z-score: -1.179703913
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.34E-37; Fold-change: 1.312148941; Z-score: 2.525130216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.02E-05; Fold-change: 0.449431772; Z-score: 0.674030736
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.631857569; Fold-change: 0.017731453; Z-score: 0.047998311
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.021593373; Fold-change: -0.14052065; Z-score: -0.59933545
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.943756768; Fold-change: 0.109113505; Z-score: 0.631653197
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.465769224; Fold-change: -0.07478042; Z-score: -0.307453265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.628335334; Fold-change: 0.193610233; Z-score: 0.283052955
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.499124067; Fold-change: 0.084547525; Z-score: 0.135876875
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.95488433; Fold-change: 0.04104952; Z-score: 0.070769183
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.006531955; Fold-change: -0.65754098; Z-score: -1.525904599
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.261382599; Fold-change: -0.383810611; Z-score: -0.369204805
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 16 Disease of the genitourinary system
             [+] ICD-11: GA10 Endometriosis Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.451477461; Fold-change: 0.1120287; Z-score: 0.12746774
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: GC00 Cystitis Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.010957113; Fold-change: 0.435850801; Z-score: 1.684201173
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 19 Certain condition originating in the perinatal period
             [+] ICD-11: KA21 Short gestation disorder Click to Show/Hide the Full List
The Studied Tissue Myometrium
The Specified Disease Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.244246273; Fold-change: 0.080858437; Z-score: 0.78893624
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
ICD-11: 20 Developmental anomaly
             [+] ICD-11: LD2C Overgrowth syndrome Click to Show/Hide the Full List
The Studied Tissue Adipose tissue
The Specified Disease Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.282494609; Fold-change: 0.034395399; Z-score: 1.040588651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
             [+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Perituberal tissue
The Specified Disease Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002053449; Fold-change: 0.704637065; Z-score: 55.80340641
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue
Download TF expression data in the tissue of healthy individual
References
1 NRF3 activates mTORC1 arginine-dependently for cancer cell viability. iScience. 2023 Jan 25;26(2):106045.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.