Transcription Factor (TF) Information

General Information of This TF
TF ID	TFD0246
TF name	General transcription factor II-I (GTF2I)
Synonyms	BAP-135; BAP135; BTK-associated protein 135; Bruton tyrosine kinase-associated protein 135; GTF2I; GTFII-I; SPIN; SRF-Phox1-interacting protein; TFII-I; WBSCR6; Williams-Beuren syndrome chromosomal region 6 protein
Gene Name	GTF2I
Gene ID	2969
TF Classification	Superclass	Yet undefined DNA-binding domains
	Class	GTF2I domain factors
	Family	TFII-I-related factors
	Subfamily	Other factors
Function	This transcription factor is a coregulator for USF1 by binding independently two promoter elements, a pyrimidine-rich initiator (Inr) and an upstream E-box.
Sequence	MAQVAMSTLPVEDEESSESRMVVTFLMSALESMCKELAKSKAEVACIAVYETDVFVVGTE RGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYF CFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGI SFIIKRPFLEPKKHVGGRVMVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVK EESEDPDYYQYNIQAGPSETDDVDEKQPLSKPLQGSHHSSEGNEGTEMEVPAEDSTQHVP SETSEDPEVEVTIEDDDYSPPSKRPKANELPQPPVPEPANAGKRKVREFNFEKWNARITD LRKQVEELFERKYAQAIKAKGPVTIPYPLFQSHVEDLYVEGLPEGIPFRRPSTYGIPRLE RILLAKERIRFVIKKHELLNSTREDLQLDKPASGVKEEWYARITKLRKMVDQLFCKKFAE ALGSTEAKAVPYQKFEAHPNDLYVEGLPENIPFRSPSWYGIPRLEKIIQVGNRIKFVIKR PELLTHSTTEVTQPRTNTPVKEDWNVRITKLRKQVEEIFNLKFAQALGLTEAVKVPYPVF ESNPEFLYVEGLPEGIPFRSPTWFGIPRLERIVRGSNKIKFVVKKPELVISYLPPGMASK INTKALQSPKRPRSPGSNSKVPEIEVTVEGPNNNNPQTSAVRTPTQTNGSNVPFKPRGRE FSFEAWNAKITDLKQKVENLFNEKCGEALGLKQAVKVPFALFESFPEDFYVEGLPEGVPF RRPSTFGIPRLEKILRNKAKIKFIIKKPEMFETAIKESTSSKSPPRKINSSPNVNTTASG VEDLNIIQVTIPDDDNERLSKVEKARQLREQVNDLFSRKFGEAIGMGFPVKVPYRKITIN PGCVVVDGMPPGVSFKAPSYLEISSMRRILDSAEFIKFTVIRPFPGLVINNQLVDQSESE GPVIQESAEPSQLEVPATEEIKETDGSSQIKQEPDPTW
Uniprot ID	GTF2I_HUMAN
Ensembl ID	ENSG00000263001
HGNC ID	HGNC:4659

Drug Transporter(s) Regulated by This TF
Direct binding
ABCA3	Transporter Info	ChIP sequencing in foreskin	[1]
ABCA7	Transporter Info	ChIP sequencing in foreskin	[2]
CACT	Transporter Info	ChIP sequencing in foreskin	[2]
COPT2	Transporter Info	ChIP sequencing in foreskin	[1]
CTL1	Transporter Info	ChIP sequencing in foreskin	[3]
CTL2	Transporter Info	ChIP sequencing in foreskin	[4]
CTL4	Transporter Info	ChIP sequencing in foreskin	[1]
ENT2	Transporter Info	ChIP sequencing in foreskin	[2]
ENT3	Transporter Info	ChIP sequencing in foreskin	[3]
FATP1	Transporter Info	ChIP sequencing in foreskin	[1]
GLUT1	Transporter Info	ChIP sequencing in foreskin	[4]
KCNK4	Transporter Info	ChIP sequencing in foreskin	[4]
MDU1	Transporter Info	ChIP sequencing in foreskin	[2]
MRP3	Transporter Info	ChIP sequencing in foreskin	[4]
NADC3	Transporter Info	ChIP sequencing in foreskin	[4]
NPT2A	Transporter Info	ChIP sequencing in foreskin	[2]
ORNT3	Transporter Info	ChIP sequencing in foreskin	[3]
PHT2	Transporter Info	ChIP sequencing in foreskin	[1]
PROT	Transporter Info	ChIP sequencing in foreskin	[1]
SGLT2	Transporter Info	ChIP sequencing in foreskin	[3]
SLC11A1	Transporter Info	ChIP sequencing in foreskin	[3]
SLC25A42	Transporter Info	ChIP sequencing in foreskin	[4]
SLC38A10	Transporter Info	ChIP sequencing in foreskin	[3]
SLC48A1	Transporter Info	ChIP sequencing in foreskin	[2]
SLC8A2	Transporter Info	ChIP sequencing in foreskin	[2]
SLC9A8	Transporter Info	ChIP sequencing in foreskin	[3]
TAUT	Transporter Info	ChIP sequencing in foreskin	[4]
ZIP13	Transporter Info	ChIP sequencing in foreskin	[4]
ZIP6	Transporter Info	ChIP sequencing in foreskin	[1]

Disease-specific Protein Abundances of TF
ICD-11: 01 Certain infectious or parasitic disease
[+] ICD-11: 1C1H Necrotising ulcerative gingivitis		Click to Show/Hide the Full List
The Studied Tissue	Gingival tissue
The Specified Disease	Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001456244; Fold-change: -0.270741845; Z-score: -0.520558697
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1E30 Influenza		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.183755598; Fold-change: -0.772117672; Z-score: -1.768370954
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1E51 Chronic viral hepatitis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.587478281; Fold-change: -0.097604746; Z-score: -0.445679294
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1G41 Sepsis with septic shock		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.74E-06; Fold-change: -0.058833864; Z-score: -0.110427918
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA40 Respiratory syncytial virus infection		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.026900921; Fold-change: -0.243732335; Z-score: -0.968216586
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA42 Rhinovirus infection		Click to Show/Hide the Full List
The Studied Tissue	Nasal epithelium tissue
The Specified Disease	Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.057860015; Fold-change: 0.10301864; Z-score: 0.538404819
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: KA60 Neonatal sepsis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.42E-05; Fold-change: 0.420418674; Z-score: 0.654804786
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 02 Neoplasm
[+] ICD-11: 2A00 Brain cancer		Click to Show/Hide the Full List
The Studied Tissue	Nervous tissue
The Specified Disease	Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.39E-15; Fold-change: 0.092603233; Z-score: 0.134516295
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.94E-05; Fold-change: 0.242286527; Z-score: 9.598830138
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	White matter tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00011119; Fold-change: 0.730800356; Z-score: 1.629840918
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A20 Myeloproliferative neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.128996956; Fold-change: -0.105411541; Z-score: -0.851467513
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.008260223; Fold-change: -0.077918777; Z-score: -0.573297928
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A36 Myelodysplastic syndrome		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.386854443; Fold-change: -0.138647659; Z-score: -0.491947648
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.016885379; Fold-change: 0.28368915; Z-score: 2.184373021
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A81 Diffuse large B-cell lymphoma		Click to Show/Hide the Full List
The Studied Tissue	Tonsil tissue
The Specified Disease	Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.526375848; Fold-change: 0.348274582; Z-score: 0.837525964
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A83 Plasma cell neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.926792042; Fold-change: 0.042549983; Z-score: 0.171057299
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Bone marrow
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.141112576; Fold-change: 0.014435511; Z-score: 0.051639244
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B33 Leukaemia		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.90E-08; Fold-change: 0.220948596; Z-score: 0.459334119
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B6E Oral cancer		Click to Show/Hide the Full List
The Studied Tissue	Oral tissue
The Specified Disease	Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.004869214; Fold-change: 0.281685327; Z-score: 0.420401143
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.000812863; Fold-change: -1.217002598; Z-score: -0.97810088
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B70 Esophageal cancer		Click to Show/Hide the Full List
The Studied Tissue	Esophagus
The Specified Disease	Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.164188719; Fold-change: -0.541044328; Z-score: -0.972301197
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: 2B72 Stomach cancer		Click to Show/Hide the Full List
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.250381023; Fold-change: 0.087255224; Z-score: 0.162621836
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.95E-07; Fold-change: 0.374635308; Z-score: 1.274290998
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B90 Colon cancer		Click to Show/Hide the Full List
The Studied Tissue	Colon tissue
The Specified Disease	Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002849119; Fold-change: 0.076451115; Z-score: 0.119058434
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.88E-22; Fold-change: 1.089897911; Z-score: 1.385162046
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C10 Pancreatic cancer		Click to Show/Hide the Full List
The Studied Tissue	Pancreas
The Specified Disease	Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00705391; Fold-change: 0.82461583; Z-score: 1.035868869
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.000502491; Fold-change: -0.570928196; Z-score: -0.8977898
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C12 Liver cancer		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.026156258; Fold-change: 0.363148684; Z-score: 0.444161953
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.85E-23; Fold-change: 0.405945357; Z-score: 0.804745019
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.200012779; Fold-change: 0.143478154; Z-score: 0.266208236
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual Download TF expression data in the tissue of the other disease section
[+] ICD-11: 2C25 Lung cancer		Click to Show/Hide the Full List
The Studied Tissue	Lung tissue
The Specified Disease	Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.583044468; Fold-change: -0.020385921; Z-score: -0.020439419
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.127511255; Fold-change: 0.024554202; Z-score: 0.021901929
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C30 Skin cancer		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.063779158; Fold-change: 0.718835765; Z-score: 0.81902568
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Skin
The Specified Disease	Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.85E-06; Fold-change: -0.955613376; Z-score: -1.012007026
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.17E-12; Fold-change: 0.403031439; Z-score: 0.615689553
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C6Z Breast cancer		Click to Show/Hide the Full List
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.84E-20; Fold-change: 0.503000696; Z-score: 0.647786945
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.004024233; Fold-change: 0.27779874; Z-score: 0.338302306
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C73 Ovarian cancer		Click to Show/Hide the Full List
The Studied Tissue	Ovarian tissue
The Specified Disease	Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.182278847; Fold-change: 0.590846336; Z-score: 0.582402042
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.973043903; Fold-change: 0.910522679; Z-score: 0.590358404
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C77 Cervical cancer		Click to Show/Hide the Full List
The Studied Tissue	Cervical tissue
The Specified Disease	Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.92E-05; Fold-change: -0.014944519; Z-score: -0.052911083
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C78 Uterine cancer		Click to Show/Hide the Full List
The Studied Tissue	Endometrium tissue
The Specified Disease	Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.046778693; Fold-change: 0.093691816; Z-score: 0.107571201
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.104411192; Fold-change: 0.050706553; Z-score: 0.15453373
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C82 Prostate cancer		Click to Show/Hide the Full List
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.003211315; Fold-change: 0.21869183; Z-score: 0.23934427
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C90 Renal cancer		Click to Show/Hide the Full List
The Studied Tissue	Kidney
The Specified Disease	Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.218972059; Fold-change: 0.334255766; Z-score: 0.417917563
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.498763457; Fold-change: -0.116041994; Z-score: -0.212462739
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C92 Ureter cancer		Click to Show/Hide the Full List
The Studied Tissue	Urothelium
The Specified Disease	Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.060706524; Fold-change: 0.040004281; Z-score: 0.417677475
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C94 Bladder cancer		Click to Show/Hide the Full List
The Studied Tissue	Bladder tissue
The Specified Disease	Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.73E-06; Fold-change: -2.00278893; Z-score: -5.366840842
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D02 Retinal cancer		Click to Show/Hide the Full List
The Studied Tissue	Uvea
The Specified Disease	Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000526941; Fold-change: -0.882474217; Z-score: -2.1131104
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D10 Thyroid cancer		Click to Show/Hide the Full List
The Studied Tissue	Thyroid
The Specified Disease	Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.26E-06; Fold-change: -0.730351432; Z-score: -0.633823493
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.26589958; Fold-change: -0.223885762; Z-score: -0.299465557
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D12 Endocrine gland neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.120568711; Fold-change: 0.446424661; Z-score: 0.648654376
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.62033429; Fold-change: 0.30025325; Z-score: 0.423151661
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D42 Head and neck cancer		Click to Show/Hide the Full List
The Studied Tissue	Head and neck tissue
The Specified Disease	Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.862772284; Fold-change: -0.040325844; Z-score: -0.065742182
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 03 Disease of the blood or blood-forming organs
[+] ICD-11: 3A51 Sickle cell disorder		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.892440253; Fold-change: 0.155136068; Z-score: 0.657286498
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3A70 Aplastic anaemia		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.62297215; Fold-change: -0.245545162; Z-score: -0.41019922
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3B63 Thrombocytosis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.95E-05; Fold-change: -0.117136062; Z-score: -0.815795178
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3B64 Thrombocytopenia		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.387299257; Fold-change: -0.373550828; Z-score: -0.743881668
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 04 Disease of the immune system
[+] ICD-11: 4A00 Immunodeficiency		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.795663271; Fold-change: 0.001784337; Z-score: 0.010405461
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A40 Lupus erythematosus		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.146912808; Fold-change: -0.055183946; Z-score: -0.129417808
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A42 Systemic sclerosis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.93E-05; Fold-change: -0.341155013; Z-score: -1.571666986
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A43 Systemic autoimmune disease		Click to Show/Hide the Full List
The Studied Tissue	Salivary gland tissue
The Specified Disease	Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.723167203; Fold-change: 0.1019351; Z-score: 0.540528732
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.010875646; Fold-change: 0.325652644; Z-score: 1.64601607
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A62 Behcet disease		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.402769602; Fold-change: -0.065091658; Z-score: -0.235822758
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4B04 Monocyte count disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.269123219; Fold-change: -0.40932623; Z-score: -1.437421824
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 05 Endocrine, nutritional or metabolic disease
[+] ICD-11: 5A11 Type 2 diabetes mellitus		Click to Show/Hide the Full List
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.088130042; Fold-change: -0.086157885; Z-score: -0.752052852
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.3916451; Fold-change: -0.019825368; Z-score: -0.100703585
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Liver tissue
The Specified Disease	Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.06465004; Fold-change: -0.199048806; Z-score: -1.364293142
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5A80 Ovarian dysfunction		Click to Show/Hide the Full List
The Studied Tissue	Vastus lateralis muscle
The Specified Disease	Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.252499481; Fold-change: 0.110771138; Z-score: 0.422758103
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder		Click to Show/Hide the Full List
The Studied Tissue	Biceps muscle
The Specified Disease	Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.203930572; Fold-change: -0.416991312; Z-score: -1.287522266
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C56 Lysosomal disease		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.819105049; Fold-change: 0.048463134; Z-score: 0.188614405
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C80 Hyperlipoproteinaemia		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.187283738; Fold-change: -0.241672594; Z-score: -1.136944463
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.899321235; Fold-change: 0.042570851; Z-score: 0.127795184
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
[+] ICD-11: 6A02 Autism spectrum disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.623524723; Fold-change: 0.017654271; Z-score: 0.052142519
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A20 Schizophrenia		Click to Show/Hide the Full List
The Studied Tissue	Prefrontal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.873443793; Fold-change: -0.089867605; Z-score: -0.196212328
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Superior temporal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.795702074; Fold-change: -0.058937061; Z-score: -0.407460026
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A60 Bipolar disorder		Click to Show/Hide the Full List
The Studied Tissue	Prefrontal cortex
The Specified Disease	Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.193750745; Fold-change: -0.145348095; Z-score: -0.454871716
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A70 Depressive disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.627364181; Fold-change: 0.014674638; Z-score: 0.032864686
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Prefrontal cortex
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.148455826; Fold-change: -0.125762036; Z-score: -0.378209723
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 08 Disease of the nervous system
[+] ICD-11: 8A00 Parkinsonism		Click to Show/Hide the Full List
The Studied Tissue	Substantia nigra tissue
The Specified Disease	Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.562165775; Fold-change: -0.068277678; Z-score: -0.305843347
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A01 Choreiform disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.430788229; Fold-change: -0.05115716; Z-score: -0.254398974
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A20 Alzheimer disease		Click to Show/Hide the Full List
The Studied Tissue	Entorhinal cortex
The Specified Disease	Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.010213926; Fold-change: -0.17354611; Z-score: -0.404832841
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A2Y Neurocognitive impairment		Click to Show/Hide the Full List
The Studied Tissue	White matter tissue
The Specified Disease	HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.257334685; Fold-change: -0.130951372; Z-score: -0.477620397
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A40 Multiple sclerosis		Click to Show/Hide the Full List
The Studied Tissue	Plasmacytoid dendritic cells
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.282547036; Fold-change: 0.28395967; Z-score: 0.595035939
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Spinal cord
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.470651564; Fold-change: -0.175760224; Z-score: -0.475311101
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: 8A60 Epilepsy		Click to Show/Hide the Full List
The Studied Tissue	Peritumoral cortex tissue
The Specified Disease	Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.885577546; Fold-change: 0.064293151; Z-score: 0.143934315
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
The Studied Tissue	Whole blood
The Specified Disease	Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.023736647; Fold-change: -0.48497459; Z-score: -1.24659512
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B01 Subarachnoid haemorrhage		Click to Show/Hide the Full List
The Studied Tissue	Intracranial artery
The Specified Disease	Intracranial aneurysm [ICD-11:8B01.0]
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B11 Cerebral ischaemic stroke		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00227076; Fold-change: -0.243663192; Z-score: -0.686279981
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specified Disease	Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.318020426; Fold-change: -0.117221533; Z-score: -0.188325608
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B60 Motor neuron disease		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.207670463; Fold-change: -0.07416879; Z-score: -0.238320559
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.841368575; Fold-change: -0.053558483; Z-score: -0.252111392
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8C70 Muscular dystrophy		Click to Show/Hide the Full List
The Studied Tissue	Muscle tissue
The Specified Disease	Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.290910367; Fold-change: 0.277170991; Z-score: 0.374384588
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8C75 Distal myopathy		Click to Show/Hide the Full List
The Studied Tissue	Muscle tissue
The Specified Disease	Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.294572608; Fold-change: 0.20347915; Z-score: 0.577692923
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 09 Disease of the visual system
[+] ICD-11: 9A96 Anterior uveitis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral monocyte
The Specified Disease	Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.264871325; Fold-change: -0.072780897; Z-score: -0.529621358
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 11 Disease of the circulatory system
[+] ICD-11: BA41 Myocardial infarction		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.135130798; Fold-change: -0.16805407; Z-score: -0.247140783
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: BA80 Coronary artery disease		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.361467146; Fold-change: -0.176962862; Z-score: -0.167195716
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: BB70 Aortic valve stenosis		Click to Show/Hide the Full List
The Studied Tissue	Calcified aortic valve
The Specified Disease	Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.020305529; Fold-change: 0.127230797; Z-score: 0.7012911
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 12 Disease of the respiratory system
[+] ICD-11: 7A40 Central sleep apnoea		Click to Show/Hide the Full List
The Studied Tissue	Hyperplastic tonsil
The Specified Disease	Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.020499469; Fold-change: 0.136007128; Z-score: 1.760891239
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA08 Vasomotor or allergic rhinitis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.09343111; Fold-change: 0.266686373; Z-score: 1.174384203
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA0A Chronic rhinosinusitis		Click to Show/Hide the Full List
The Studied Tissue	Sinus mucosa tissue
The Specified Disease	Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.879015817; Fold-change: -0.07800198; Z-score: -0.182239046
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA22 Chronic obstructive pulmonary disease		Click to Show/Hide the Full List
The Studied Tissue	Small airway epithelium
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.82E-06; Fold-change: -0.507187994; Z-score: -0.91706405
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Lung tissue
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.609748719; Fold-change: -0.124395158; Z-score: -0.181963957
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA23 Asthma		Click to Show/Hide the Full List
The Studied Tissue	Nasal and bronchial airway
The Specified Disease	Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.69E-05; Fold-change: -0.08014248; Z-score: -0.029636036
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CB03 Idiopathic interstitial pneumonitis		Click to Show/Hide the Full List
The Studied Tissue	Lung tissue
The Specified Disease	Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.420674551; Fold-change: 0.260453365; Z-score: 0.906812736
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 13 Disease of the digestive system
[+] ICD-11: DA0C Periodontal disease		Click to Show/Hide the Full List
The Studied Tissue	Gingival tissue
The Specified Disease	Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.000541095; Fold-change: -0.283354069; Z-score: -0.532515901
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: DA42 Gastritis		Click to Show/Hide the Full List
The Studied Tissue	Gastric antrum tissue
The Specified Disease	Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.1845167; Fold-change: -0.130185284; Z-score: -3.379327615
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: DB92 Non-alcoholic fatty liver disease		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.768642431; Fold-change: -0.143692207; Z-score: -0.257341085
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: DB99 Hepatic failure		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.10444038; Fold-change: -0.107346369; Z-score: -0.503420083
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: DD71 Ulcerative colitis		Click to Show/Hide the Full List
The Studied Tissue	Colon mucosal tissue
The Specified Disease	Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.392895561; Fold-change: 0.012896488; Z-score: 0.08854325
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
[+] ICD-11: DD91 Irritable bowel syndrome		Click to Show/Hide the Full List
The Studied Tissue	Rectal colon tissue
The Specified Disease	Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.302693994; Fold-change: 0.080573157; Z-score: 0.281077323
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 14 Disease of the skin
[+] ICD-11: EA80 Atopic eczema		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000634175; Fold-change: -0.987519728; Z-score: -1.453786598
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: EA90 Psoriasis		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.632424265; Fold-change: 0.078431716; Z-score: 0.101423722
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.04E-36; Fold-change: 1.415296629; Z-score: 2.843337966
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: ED63 Acquired hypomelanotic disorder		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.863185187; Fold-change: -0.070126826; Z-score: -0.204197966
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: ED70 Alopecia or hair loss		Click to Show/Hide the Full List
The Studied Tissue	Skin from scalp
The Specified Disease	Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.906302732; Fold-change: 0.055535325; Z-score: 0.151434007
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: EK0Z Contact dermatitis		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.948276504; Fold-change: 0.264333527; Z-score: 0.434578543
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
[+] ICD-11: FA00 Osteoarthritis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.678693039; Fold-change: -0.015134886; Z-score: -0.03016895
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.019070725; Fold-change: 0.244645412; Z-score: 1.087913266
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA20 Rheumatoid arthritis		Click to Show/Hide the Full List
The Studied Tissue	Synovial tissue
The Specified Disease	Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.51E-05; Fold-change: 1.31222694; Z-score: 3.686937758
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA24 Juvenile idiopathic arthritis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.748768889; Fold-change: -0.027417664; Z-score: -0.073983399
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA92 Inflammatory spondyloarthritis		Click to Show/Hide the Full List
The Studied Tissue	Pheripheral blood
The Specified Disease	Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.159463521; Fold-change: 0.668407702; Z-score: 0.97604759
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FB83 Low bone mass disorder		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.598456656; Fold-change: 0.639611705; Z-score: 1.262817557
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 16 Disease of the genitourinary system
[+] ICD-11: GA10 Endometriosis		Click to Show/Hide the Full List
The Studied Tissue	Endometrium tissue
The Specified Disease	Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.0347774; Fold-change: -0.423893777; Z-score: -0.594644052
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: GC00 Cystitis		Click to Show/Hide the Full List
The Studied Tissue	Bladder tissue
The Specified Disease	Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.004449074; Fold-change: -0.783131893; Z-score: -2.539819658
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 19 Certain condition originating in the perinatal period
[+] ICD-11: KA21 Short gestation disorder		Click to Show/Hide the Full List
The Studied Tissue	Myometrium
The Specified Disease	Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.602272625; Fold-change: 0.01061986; Z-score: 0.014237561
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 20 Developmental anomaly
[+] ICD-11: LD2C Overgrowth syndrome		Click to Show/Hide the Full List
The Studied Tissue	Adipose tissue
The Specified Disease	Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.180236026; Fold-change: -0.069305208; Z-score: -0.843959309
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual

References
1	The Encyclopedia of DNA elements (ENCODE): data portal update. Nucleic Acids Res. 2018 Jan 4;46(D1):D794-D801
2	hTFtarget: A Comprehensive Database for Regulations of Human Transcription Factors and Their Targets. Genomics Proteomics Bioinformatics. 2020 Apr;18(2):120-469.
3	NCBI GEO: archive for functional genomics data sets--update. Nucleic Acids Res. 2013 Jan;41(D1):D991-5.
4	Closure of the NCBI SRA and implications for the long-term future of genomics data storage. Genome Biol. 2011;12(3):402.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

Transcription Factor (TF) Information

Visitor Map

Correspondence