General Information of This TF
TF ID
TFD0008
TF name
Cyclic AMP-dependent transcription factor ATF-3 (ATF3)
Synonyms
ATF3; Activating transcription factor 3; cAMP-dependent transcription factor ATF-3
Gene Name
ATF3
Gene ID
467
TF Classification Superclass Basic domains
Class Basic leucine zipper factors
Family Fos-related factors
Subfamily ATF-3-like factors
Function This transcription factor represses transcription from promoters with ATF sites. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters. Isoform 3 is a stress-induced isoform, counteracts the transcriptional repression of isoform 1.
Sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSS
ALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK
LESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQ
S
Uniprot ID
ATF3_HUMAN
Ensembl ID
ENSG00000162772
HGNC ID
HGNC:785
JASPAR ID
MA0605.2
TF Binding Frequency Matrix TFD0008
Drug Transporter(s) Regulated by This TF

Repression

MRP1

Transporter Info

Kidney failure [ICD11: GB60-GB6Z]

[1]

Direct binding

ABCA10

Transporter Info

ChIP sequencing in colon

[2]

ABCA5

Transporter Info

ChIP sequencing in bone marrow; colon

[3]

ABCA7

Transporter Info

ChIP sequencing in bone marrow; colon

[4]

ABCA9

Transporter Info

ChIP sequencing in bone marrow; colon

[5]

ABCB6

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[2]

ABCB8

Transporter Info

ChIP sequencing in bone marrow; colon

[3]

ABCG1

Transporter Info

ChIP sequencing in bone marrow; colon

[3]

AE2

Transporter Info

ChIP sequencing in bone marrow; colon; embryo; liver; lung

[3]

ANT3

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[2]

ANXA11

Transporter Info

ChIP sequencing in colon

[4]

ARALAR1

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[5]

ARALAR2

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[2]

ATP2B1

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[5]

ATP7A

Transporter Info

ChIP sequencing in blood; bone marrow; embryo; liver

[3]

BGT1

Transporter Info

ChIP sequencing in colon

[2]

CACNA1C

Transporter Info

ChIP sequencing in colon

[5]

CACNA1H

Transporter Info

ChIP sequencing in bone marrow; colon

[4]

CAT2

Transporter Info

ChIP sequencing in bone marrow; colon; liver

[2]

CCC9

Transporter Info

ChIP sequencing in colon

[5]

COPT2

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[4]

CRTR

Transporter Info

ChIP sequencing in bone marrow; colon

[4]

CTL1

Transporter Info

ChIP sequencing in colon

[5]

CTL4

Transporter Info

ChIP sequencing in bone marrow

[2]

DIC

Transporter Info

ChIP sequencing in blood; bone marrow; colon; liver

[3]

ENBT1

Transporter Info

ChIP sequencing in bone marrow; colon

[4]

ENT1

Transporter Info

ChIP sequencing in liver

[5]

ENT3

Transporter Info

ChIP sequencing in bone marrow; colon

[2]

FATP1

Transporter Info

ChIP sequencing in colon

[2]

FLOT1

Transporter Info

ChIP sequencing in bone marrow; colon

[5]

FUCT1

Transporter Info

ChIP sequencing in embryo

[5]

GDC

Transporter Info

ChIP sequencing in blood; bone marrow; colon

[3]

GLUT12

Transporter Info

ChIP sequencing in colon

[4]

GLUT14

Transporter Info

ChIP sequencing in bone marrow; colon

[2]

GLUT5

Transporter Info

ChIP sequencing in bone marrow; colon

[3]

GLUT8

Transporter Info

ChIP sequencing in bone marrow; colon

[4]

GLYT1

Transporter Info

ChIP sequencing in bone marrow; colon

[5]

KCC1

Transporter Info

ChIP sequencing in bone marrow; colon

[2]

KCC3

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo

[3]

KCC4

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[4]

KCNMA1

Transporter Info

ChIP sequencing in bone marrow; colon

[2]

KCNQ1

Transporter Info

ChIP sequencing in colon

[3]

LAT2

Transporter Info

ChIP sequencing in colon

[5]

LAT3

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[3]

MCPHA

Transporter Info

ChIP sequencing in bone marrow; colon

[4]

MCT1

Transporter Info

ChIP sequencing in blood; bone marrow; colon; liver

[3]

MCT6

Transporter Info

ChIP sequencing in colon

[2]

MCT7

Transporter Info

ChIP sequencing in bone marrow; colon

[3]

MFT

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[3]

MRP5

Transporter Info

ChIP sequencing in bone marrow; colon

[4]

MRP7

Transporter Info

ChIP sequencing in colon

[5]

NADC3

Transporter Info

ChIP sequencing in bone marrow; colon

[2]

NDCBE

Transporter Info

ChIP sequencing in colon

[4]

NPT2A

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo

[2]

NPT2C

Transporter Info

ChIP sequencing in bone marrow; colon

[3]

NRAMP2

Transporter Info

ChIP sequencing in colon

[5]

OATP4A1

Transporter Info

ChIP sequencing in bone marrow; colon

[5]

OCTN1

Transporter Info

ChIP sequencing in bone marrow; colon

[5]

OCTN2

Transporter Info

ChIP sequencing in bone marrow; colon

[5]

ODC

Transporter Info

ChIP sequencing in colon

[5]

OGC

Transporter Info

ChIP sequencing in bone marrow; colon

[4]

OSTbeta

Transporter Info

ChIP sequencing in blood; colon

[2]

PAT1

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[3]

PAT4

Transporter Info

ChIP sequencing in colon

[4]

PHC

Transporter Info

ChIP sequencing in bone marrow; colon

[2]

PIT1

Transporter Info

ChIP sequencing in bone marrow; colon; liver

[2]

PIT2

Transporter Info

ChIP sequencing in bone marrow; colon

[3]

RALBP1

Transporter Info

ChIP sequencing in bone marrow; colon; embryo

[2]

SAMC

Transporter Info

ChIP sequencing in blood; colon; embryo

[4]

SAT1

Transporter Info

ChIP sequencing in bone marrow; colon; liver

[3]

SCAMC1

Transporter Info

ChIP sequencing in colon

[3]

SCAMC3

Transporter Info

ChIP sequencing in bone marrow; colon; embryo; liver

[2]

SCN4A

Transporter Info

ChIP sequencing in bone marrow; colon; embryo

[2]

SCN8A

Transporter Info

ChIP sequencing in colon

[3]

SGLT5

Transporter Info

ChIP sequencing in bone marrow

[3]

SLC10A6

Transporter Info

ChIP sequencing in colon

[4]

SLC16A11

Transporter Info

ChIP sequencing in .

[4]

SLC16A13

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[5]

SLC17A9

Transporter Info

ChIP sequencing in blood; colon; liver

[4]

SLC22A23

Transporter Info

ChIP sequencing in bone marrow; colon

[4]

SLC24A1

Transporter Info

ChIP sequencing in bone marrow; colon

[2]

SLC25A28

Transporter Info

ChIP sequencing in colon

[5]

SLC25A33

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[4]

SLC25A36

Transporter Info

ChIP sequencing in bone marrow; colon; embryo

[5]

SLC25A37

Transporter Info

ChIP sequencing in bone marrow; colon

[2]

SLC25A38

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[3]

SLC25A42

Transporter Info

ChIP sequencing in bone marrow; colon

[4]

SLC25A5

Transporter Info

ChIP sequencing in bone marrow; colon

[5]

SLC26A2

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[4]

SLC26A9

Transporter Info

ChIP sequencing in colon

[5]

SLC27A4

Transporter Info

ChIP sequencing in bone marrow; colon; lung

[3]

SLC27A5

Transporter Info

ChIP sequencing in bone marrow; colon

[4]

SLC2A11

Transporter Info

ChIP sequencing in colon

[3]

SLC2A13

Transporter Info

ChIP sequencing in bone marrow; colon; embryo; liver

[5]

SLC2A9

Transporter Info

ChIP sequencing in blood; colon

[5]

SLC33A1

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[5]

SLC35A4

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo

[4]

SLC35A5

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[5]

SLC35B1

Transporter Info

ChIP sequencing in blood; colon

[2]

SLC35B2

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[3]

SLC35B4

Transporter Info

ChIP sequencing in bone marrow; colon; embryo

[4]

SLC35D2

Transporter Info

ChIP sequencing in colon

[2]

SLC37A2

Transporter Info

ChIP sequencing in colon

[5]

SLC37A3

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[2]

SLC38A9

Transporter Info

ChIP sequencing in colon

[4]

SLC41A2

Transporter Info

ChIP sequencing in bone marrow; colon

[2]

SLC45A3

Transporter Info

ChIP sequencing in bone marrow; colon

[3]

SLC45A4

Transporter Info

ChIP sequencing in bone marrow; colon

[4]

SLC48A1

Transporter Info

ChIP sequencing in bone marrow; colon; embryo

[5]

SLC4A11

Transporter Info

ChIP sequencing in colon

[2]

SLC50A1

Transporter Info

ChIP sequencing in colon

[5]

SLC7A6

Transporter Info

ChIP sequencing in bone marrow; colon

[3]

SLC7A7

Transporter Info

ChIP sequencing in blood; bone marrow; colon

[4]

SLC8A1

Transporter Info

ChIP sequencing in colon

[2]

SLC8B1

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[3]

SLC9A1

Transporter Info

ChIP sequencing in colon

[4]

SLC9A5

Transporter Info

ChIP sequencing in bone marrow; colon

[5]

SLC9A8

Transporter Info

ChIP sequencing in bone marrow; colon

[2]

SLC9B1

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[3]

SLC9C1

Transporter Info

ChIP sequencing in colon

[4]

SMIT2

Transporter Info

ChIP sequencing in bone marrow; colon

[4]

SMVT

Transporter Info

ChIP sequencing in colon

[5]

SNAT1

Transporter Info

ChIP sequencing in bone marrow; colon

[3]

SNAT3

Transporter Info

ChIP sequencing in liver

[4]

SNAT5

Transporter Info

ChIP sequencing in colon

[5]

SNAT6

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[2]

SNAT7

Transporter Info

ChIP sequencing in blood; bone marrow; colon; embryo; liver

[3]

SUR1

Transporter Info

ChIP sequencing in bone marrow; colon

[2]

TAPL

Transporter Info

ChIP sequencing in colon

[4]

TAUT

Transporter Info

ChIP sequencing in bone marrow; colon

[3]

ZIP1

Transporter Info

ChIP sequencing in bone marrow; colon; embryo; liver

[5]

ZIP11

Transporter Info

ChIP sequencing in blood; colon; liver

[2]

ZIP13

Transporter Info

ChIP sequencing in bone marrow; colon

[3]

ZIP14

Transporter Info

ChIP sequencing in bone marrow; colon

[4]

ZIP8

Transporter Info

ChIP sequencing in colon

[5]

ZNT3

Transporter Info

ChIP sequencing in blood; colon; embryo; liver

[2]

ZNT5

Transporter Info

ChIP sequencing in bone marrow; colon

[3]
Disease-specific Protein Abundances of TF
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.17203988; Fold-change: 0.03357202; Z-score: 0.045893729
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.066868; Fold-change: 0.455205079; Z-score: 1.655032391
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.818102902; Fold-change: -0.395766784; Z-score: -0.371395774
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.013206949; Fold-change: 0.039202269; Z-score: 0.159855628
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.006963536; Fold-change: 0.353813434; Z-score: 0.830111193
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.005235264; Fold-change: 0.145947359; Z-score: 0.616967224
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.056592311; Fold-change: -0.02059113; Z-score: -0.085672335
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.789206575; Fold-change: -0.066344392; Z-score: -0.123269326
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.352204711; Fold-change: 0.261554188; Z-score: 0.487642034
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.246188375; Fold-change: 0.682864454; Z-score: 0.795333924
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001224388; Fold-change: -0.841939329; Z-score: -1.223253521
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.325467709; Fold-change: 0.040032533; Z-score: 0.173525699
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.090017608; Fold-change: 0.124128333; Z-score: 0.682158779
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.981708792; Fold-change: -0.019147887; Z-score: -0.059192962
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.790559414; Fold-change: 0.033890085; Z-score: 0.157364819
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.898931215; Fold-change: -0.054235804; Z-score: -0.275022293
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.255225617; Fold-change: 0.246527327; Z-score: 0.593118285
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.03238607; Fold-change: 0.183007151; Z-score: 0.471229493
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.37E-42; Fold-change: 1.206506726; Z-score: 1.913562187
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.286126665; Fold-change: -0.079930678; Z-score: -0.18248926
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.872204515; Fold-change: -0.007575653; Z-score: -0.011837565
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.147862478; Fold-change: -1.158882521; Z-score: -0.59948946
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.473447265; Fold-change: -0.655552564; Z-score: -0.71886625
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.045176058; Fold-change: 0.66031297; Z-score: 0.779774336
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.009053412; Fold-change: 0.278068323; Z-score: 0.330967417
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.022364363; Fold-change: 0.217681957; Z-score: 0.288011101
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.49452161; Fold-change: 0.164705385; Z-score: 0.233267582
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.548664336; Fold-change: 0.148313885; Z-score: 0.257180405
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.306631543; Fold-change: -0.347310587; Z-score: -0.460593353
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.324091975; Fold-change: -0.149200727; Z-score: -0.180752699
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00541899; Fold-change: -0.404882682; Z-score: -0.469266474
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000389197; Fold-change: -0.056891056; Z-score: -0.065319255
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.885093981; Fold-change: -0.062076961; Z-score: -0.16554048
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.77E-23; Fold-change: -1.267633755; Z-score: -0.958695152
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 4.87E-14; Fold-change: -1.362349069; Z-score: -0.996948861
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.533723245; Fold-change: 0.171912057; Z-score: 0.127478687
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.06E-10; Fold-change: -0.372061433; Z-score: -0.44193177
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.64E-08; Fold-change: 0.248179924; Z-score: 0.546064032
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.61E-16; Fold-change: -0.790132364; Z-score: -0.611268075
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.70E-07; Fold-change: -1.226009616; Z-score: -0.877088052
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.609214755; Fold-change: -0.113546463; Z-score: -0.108063505
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.100019489; Fold-change: 0.357641375; Z-score: 0.477898779
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.038520581; Fold-change: 0.12900412; Z-score: 0.308447775
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.290084224; Fold-change: 0.126358306; Z-score: 0.12309447
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.047378654; Fold-change: 0.235795908; Z-score: 0.543912839
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.224033923; Fold-change: -0.583829268; Z-score: -0.35763619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.756907925; Fold-change: 0.135885703; Z-score: 0.143764549
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.09E-09; Fold-change: -1.150829961; Z-score: -1.138894144
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.628903962; Fold-change: 0.01073767; Z-score: 0.014722962
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000313212; Fold-change: 1.14615754; Z-score: 2.653998507
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.965272601; Fold-change: 0.07100877; Z-score: 0.139704373
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.60E-12; Fold-change: -1.300212371; Z-score: -0.919033344
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.001603513; Fold-change: -0.555965851; Z-score: -0.453274587
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 1.06E-06; Fold-change: -0.613366244; Z-score: -1.861596358
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.531771396; Fold-change: -0.442893966; Z-score: -0.41493775
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.053258344; Fold-change: -0.530795031; Z-score: -0.443339414
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.202873366; Fold-change: -0.045525423; Z-score: -0.059008592
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.046177914; Fold-change: 0.193526672; Z-score: 1.122709761
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.396062979; Fold-change: -0.132517333; Z-score: -0.260842743
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.349695395; Fold-change: 0.144818306; Z-score: 0.600358552
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.766832625; Fold-change: 0.144581843; Z-score: 0.389482668
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000996745; Fold-change: 0.145578233; Z-score: 1.961282082
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.508438305; Fold-change: 0.055480449; Z-score: 0.071578817
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.059490309; Fold-change: 0.159408795; Z-score: 0.478411594
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.382408329; Fold-change: -0.06110678; Z-score: -0.520268754
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.046737364; Fold-change: -0.239577162; Z-score: -1.192605582
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.656076482; Fold-change: 0.171313616; Z-score: 0.302448794
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.640417649; Fold-change: 0.789344079; Z-score: 0.723953673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.446103164; Fold-change: -0.139803159; Z-score: -0.657598142
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.481428205; Fold-change: 0.037208917; Z-score: 0.166829241
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.586486437; Fold-change: -0.023175694; Z-score: -0.101327919
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.494225882; Fold-change: -0.045105535; Z-score: -0.183768519
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.995806128; Fold-change: -0.069335815; Z-score: -0.126759093
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.376640011; Fold-change: 0.014987232; Z-score: 0.107287989
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.355934522; Fold-change: -0.079682332; Z-score: -0.524476216
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.480052705; Fold-change: -0.029378553; Z-score: -0.169124553
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.307579368; Fold-change: -0.02871082; Z-score: -0.099844441
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.136350807; Fold-change: 0.068628281; Z-score: 0.214605099
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.887420449; Fold-change: 0.052767181; Z-score: 0.173689758
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.629082705; Fold-change: -0.041673291; Z-score: -0.218593995
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.929999119; Fold-change: 0.014424848; Z-score: 0.072865635
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.01968707; Fold-change: 0.059166843; Z-score: 0.405760544
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.687677474; Fold-change: 0.040435682; Z-score: 0.075304391
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.310912721; Fold-change: 0.163539627; Z-score: 0.674154947
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.920388334; Fold-change: 0.027763274; Z-score: 0.079940297
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.558026134; Fold-change: 0.101193242; Z-score: 0.155190719
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.079831631; Fold-change: 0.518758259; Z-score: 1.17685664
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.513199381; Fold-change: 0.341078249; Z-score: 0.620717323
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.023281138; Fold-change: 0.419057675; Z-score: 1.787634913
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.539387486; Fold-change: 0.237932555; Z-score: 0.301167498
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.434412406; Fold-change: -0.527058905; Z-score: -0.466489942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.013210176; Fold-change: -0.184704481; Z-score: -0.639802657
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.022086894; Fold-change: 0.606395307; Z-score: 0.583534127
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.496734597; Fold-change: -0.0916; Z-score: -0.399752942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.037960937; Fold-change: -0.422038771; Z-score: -1.578949507
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003355957; Fold-change: 0.700005928; Z-score: 1.398427704
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.813697479; Fold-change: 0.089374037; Z-score: 0.10881232
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 09 Disease of the visual system
             [+] ICD-11: 9A96 Anterior uveitis Click to Show/Hide the Full List
The Studied Tissue Peripheral monocyte
The Specified Disease Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.215758801; Fold-change: -0.720260551; Z-score: -0.651202431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 11 Disease of the circulatory system
             [+] ICD-11: BA41 Myocardial infarction Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.54E-10; Fold-change: 0.692966306; Z-score: 1.230950704
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BA80 Coronary artery disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.676643314; Fold-change: -0.081770405; Z-score: -0.534623735
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BB70 Aortic valve stenosis Click to Show/Hide the Full List
The Studied Tissue Calcified aortic valve
The Specified Disease Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.883671041; Fold-change: -0.066458135; Z-score: -0.205757769
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.870830953; Fold-change: -0.110514376; Z-score: -0.329042028
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.571747918; Fold-change: -0.117282069; Z-score: -0.220998086
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.015458899; Fold-change: -0.634679411; Z-score: -1.435102001
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.162866243; Fold-change: -0.168979769; Z-score: -0.236702838
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.24217991; Fold-change: -0.168219806; Z-score: -0.142752185
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00048521; Fold-change: -0.399729885; Z-score: -0.288023539
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.010064553; Fold-change: -1.644946993; Z-score: -2.41530651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.077089452; Fold-change: 0.130678557; Z-score: 0.164567492
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.217098195; Fold-change: 0.096751087; Z-score: 2.775225531
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.310697816; Fold-change: 0.191145126; Z-score: 0.268197541
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.269900673; Fold-change: 0.272003287; Z-score: 0.858695255
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.036669064; Fold-change: 0.038633718; Z-score: 0.138836304
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.903046195; Fold-change: -0.102664878; Z-score: -0.22596038
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.026374091; Fold-change: -0.084578905; Z-score: -0.378384365
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.72E-09; Fold-change: -0.434488137; Z-score: -0.477727544
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.59E-12; Fold-change: 0.461807769; Z-score: 1.212379549
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.441666054; Fold-change: -0.086924645; Z-score: -0.201036416
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.184276655; Fold-change: 0.158164443; Z-score: 0.218720799
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.122214662; Fold-change: 0.106588534; Z-score: 0.52523241
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.463949182; Fold-change: 0.037522306; Z-score: 0.295315052
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.350597445; Fold-change: 0.11980053; Z-score: 0.509978442
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.38E-06; Fold-change: 1.058204328; Z-score: 3.604356021
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.223901114; Fold-change: 0.07096406; Z-score: 0.184414283
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.495841236; Fold-change: 0.403329718; Z-score: 0.568314782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.949270814; Fold-change: 0.130399467; Z-score: 0.224342995
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 16 Disease of the genitourinary system
             [+] ICD-11: GA10 Endometriosis Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.618894983; Fold-change: -0.391138522; Z-score: -0.311105589
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: GC00 Cystitis Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.074446096; Fold-change: 0.279806257; Z-score: 2.07144605
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 19 Certain condition originating in the perinatal period
             [+] ICD-11: KA21 Short gestation disorder Click to Show/Hide the Full List
The Studied Tissue Myometrium
The Specified Disease Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.984038574; Fold-change: 0.025114669; Z-score: 0.062066531
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 20 Developmental anomaly
             [+] ICD-11: LD2C Overgrowth syndrome Click to Show/Hide the Full List
The Studied Tissue Adipose tissue
The Specified Disease Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.028614251; Fold-change: 0.392636635; Z-score: 4.30480966
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Perituberal tissue
The Specified Disease Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.146398178; Fold-change: -0.138458141; Z-score: -0.680218852
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
References
1 Interferon-gamma plays protective roles in sodium arsenite-induced renal injury by up-regulating intrarenal multidrug resistance-associated protein 1 expression. Am J Pathol. 2006 Oct;169(4):1118-28.
2 hTFtarget: A Comprehensive Database for Regulations of Human Transcription Factors and Their Targets. Genomics Proteomics Bioinformatics. 2020 Apr;18(2):120-469.
3 NCBI GEO: archive for functional genomics data sets--update. Nucleic Acids Res. 2013 Jan;41(D1):D991-5.
4 Closure of the NCBI SRA and implications for the long-term future of genomics data storage. Genome Biol. 2011;12(3):402.
5 The Encyclopedia of DNA elements (ENCODE): data portal update. Nucleic Acids Res. 2018 Jan 4;46(D1):D794-D801

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.