General Information of This TF
TF ID
TFD0166
TF name
Transcription factor 21 (TCF21)
Synonyms
Capsulin; Class A basic helix-loop-helix protein 23; Epicardin; POD1; Pod-1; Podocyte-expressed 1; TCF-21; TCF21; bHLHa23
Gene Name
TCF21
Gene ID
6943
TF Classification Superclass Basic domains
Class Basic helix-loop-helix factors
Family Tal-related factors
Subfamily Mesp-like factors
Function This transcription factor is a transcriptional regulator.
Sequence
MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRR
KAPTKKSPLSGVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDT
LRLASSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS
Uniprot ID
TCF21_HUMAN
Ensembl ID
ENSG00000118526
HGNC ID
HGNC:11632
JASPAR ID
MA1568.1
TF Binding Frequency Matrix TFD0166
Drug Transporter(s) Regulated by This TF

Repression

CACNA1B

Transporter Info

Adrenocortical carcinoma [ICD11: 2D11.0]

[1]

Direct binding

ABCA7

Transporter Info

ChIP sequencing in coronary artery

[2]

ABCB6

Transporter Info

ChIP sequencing in coronary artery

[3]

ABCB8

Transporter Info

ChIP sequencing in coronary artery

[4]

AE2

Transporter Info

ChIP sequencing in coronary artery

[2]

ANXA2

Transporter Info

ChIP sequencing in coronary artery

[5]

ASCT2

Transporter Info

ChIP sequencing in coronary artery

[4]

CTL1

Transporter Info

ChIP sequencing in coronary artery

[2]

CTL2

Transporter Info

ChIP sequencing in coronary artery

[3]

ENT1

Transporter Info

ChIP sequencing in coronary artery

[3]

GLUT14

Transporter Info

ChIP sequencing in coronary artery

[4]

KCNK4

Transporter Info

ChIP sequencing in coronary artery

[2]

LAT4

Transporter Info

ChIP sequencing in coronary artery

[5]

MCT2

Transporter Info

ChIP sequencing in coronary artery

[3]

MRP7

Transporter Info

ChIP sequencing in coronary artery

[5]

NADC3

Transporter Info

ChIP sequencing in coronary artery

[2]

OCTN1

Transporter Info

ChIP sequencing in coronary artery

[2]

OGC

Transporter Info

ChIP sequencing in coronary artery

[3]

PIT1

Transporter Info

ChIP sequencing in coronary artery

[5]

PROT

Transporter Info

ChIP sequencing in coronary artery

[4]

SCAMC2

Transporter Info

ChIP sequencing in coronary artery

[4]

SLC26A6

Transporter Info

ChIP sequencing in coronary artery

[5]

SLC27A5

Transporter Info

ChIP sequencing in coronary artery

[2]

SLC35B2

Transporter Info

ChIP sequencing in coronary artery

[5]

SLC35E4

Transporter Info

ChIP sequencing in coronary artery

[2]

SLC45A3

Transporter Info

ChIP sequencing in coronary artery

[4]

SLC48A1

Transporter Info

ChIP sequencing in coronary artery

[5]

SLC50A1

Transporter Info

ChIP sequencing in coronary artery

[3]

SLC7A6

Transporter Info

ChIP sequencing in coronary artery

[5]

SLC8A1

Transporter Info

ChIP sequencing in coronary artery

[2]

SLC9A1

Transporter Info

ChIP sequencing in coronary artery

[3]

SLC9A8

Transporter Info

ChIP sequencing in coronary artery

[4]

SNAT6

Transporter Info

ChIP sequencing in coronary artery

[3]

ZIP1

Transporter Info

ChIP sequencing in coronary artery

[4]

ZIP11

Transporter Info

ChIP sequencing in coronary artery

[5]

ZIP13

Transporter Info

ChIP sequencing in coronary artery

[2]

ZIP14

Transporter Info

ChIP sequencing in coronary artery

[3]

ZIP8

Transporter Info

ChIP sequencing in coronary artery

[4]
Disease-specific Protein Abundances of TF
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.779399923; Fold-change: -0.005221013; Z-score: -0.03226681
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.226005657; Fold-change: 0.069948742; Z-score: 0.810153513
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.643371982; Fold-change: 0.045587743; Z-score: 0.30532112
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.489180364; Fold-change: 0.002879737; Z-score: 0.01618259
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.845322335; Fold-change: 0.030662161; Z-score: 0.306470198
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.811092839; Fold-change: -0.008511328; Z-score: -0.108560633
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.028781784; Fold-change: -0.104021877; Z-score: -0.597671775
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001716501; Fold-change: -0.028115612; Z-score: -0.179064844
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.452159329; Fold-change: 0.012249555; Z-score: 0.267090406
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001360103; Fold-change: -0.392962686; Z-score: -1.795184679
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.043824884; Fold-change: -0.130421993; Z-score: -0.641219943
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.382857766; Fold-change: 0.02489403; Z-score: 0.201281174
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.015759844; Fold-change: 0.058592685; Z-score: 0.514256891
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.892729943; Fold-change: -0.022902281; Z-score: -0.148174252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.567613617; Fold-change: -0.019238607; Z-score: -0.179302769
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.313175732; Fold-change: -0.03522317; Z-score: -0.23866172
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.889389488; Fold-change: -0.020848635; Z-score: -0.148718788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.21657646; Fold-change: -0.054579857; Z-score: -0.647691189
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.834595868; Fold-change: 0.000581054; Z-score: 0.003439196
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.017769035; Fold-change: -0.056047412; Z-score: -0.326928609
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.085703379; Fold-change: -0.049179291; Z-score: -0.273356513
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000349983; Fold-change: -2.272305091; Z-score: -5.276062363
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.506287052; Fold-change: -0.286012049; Z-score: -0.882382834
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.095373408; Fold-change: -0.65116725; Z-score: -1.249512988
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.54E-67; Fold-change: -1.714060781; Z-score: -2.581167988
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.19E-25; Fold-change: -1.129870771; Z-score: -1.396475345
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.24E-05; Fold-change: -1.425550369; Z-score: -4.040663431
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.96E-05; Fold-change: -1.528531146; Z-score: -4.194128616
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.043121206; Fold-change: -0.296901114; Z-score: -0.392371499
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.079583813; Fold-change: 0.113741778; Z-score: 0.114952651
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.77E-23; Fold-change: -0.941286001; Z-score: -3.090278682
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 9.30E-97; Fold-change: -0.920827147; Z-score: -3.160791599
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.016593452; Fold-change: -0.945295565; Z-score: -2.847965485
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.68E-136; Fold-change: -3.260730488; Z-score: -4.137261749
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.50E-94; Fold-change: -3.404942351; Z-score: -4.695682527
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.213419206; Fold-change: 0.018591739; Z-score: 0.017097051
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.81E-14; Fold-change: -0.215199578; Z-score: -0.779544821
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.001867329; Fold-change: 0.100815703; Z-score: 0.43135354
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.06E-24; Fold-change: -0.130769791; Z-score: -0.814554098
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000443513; Fold-change: -0.121869111; Z-score: -0.495566581
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000641958; Fold-change: -3.56628345; Z-score: -2.293809318
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.003066073; Fold-change: -1.915646604; Z-score: -1.468460655
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.757546076; Fold-change: 0.058452998; Z-score: 0.258548647
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003774836; Fold-change: -0.233662342; Z-score: -0.400505362
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.002673578; Fold-change: 0.174816307; Z-score: 1.145058235
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.583420484; Fold-change: 0.010364185; Z-score: 0.014314404
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.11E-05; Fold-change: -2.566703198; Z-score: -1.882341798
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 6.06E-56; Fold-change: -2.442838443; Z-score: -4.412366128
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.550669519; Fold-change: -0.05453665; Z-score: -0.309216522
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.89E-05; Fold-change: -3.806256836; Z-score: -4.726448874
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.612310392; Fold-change: 0.025846717; Z-score: 0.281865429
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002091974; Fold-change: 0.051945386; Z-score: 0.266609262
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.150875396; Fold-change: 0.03926961; Z-score: 0.23678516
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 1.97E-24; Fold-change: -1.217041345; Z-score: -6.70536748
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001134008; Fold-change: -0.745670357; Z-score: -1.49697292
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.007158701; Fold-change: -0.676161309; Z-score: -1.2623891
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.656441133; Fold-change: 0.00329823; Z-score: 0.022549891
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.092852554; Fold-change: 0.116937061; Z-score: 0.949474633
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.016814772; Fold-change: 0.218854554; Z-score: 0.922696942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.522459583; Fold-change: -0.022508015; Z-score: -0.172929172
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.663338647; Fold-change: 0.105122885; Z-score: 0.519661411
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.252433429; Fold-change: -0.000282488; Z-score: -0.003794622
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000724314; Fold-change: -0.073464274; Z-score: -0.253517369
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001319135; Fold-change: 0.115575245; Z-score: 2.007199861
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.430048647; Fold-change: -0.018737096; Z-score: -0.077586676
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.26697511; Fold-change: -0.13985876; Z-score: -0.916795281
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.980245274; Fold-change: 0.015916199; Z-score: 0.088106667
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.756679438; Fold-change: 0.057143435; Z-score: 0.487048577
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.011794629; Fold-change: -0.589652735; Z-score: -1.863907767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.494237345; Fold-change: -0.01676074; Z-score: -0.097160937
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.826984118; Fold-change: -0.041240287; Z-score: -0.179195306
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.231331822; Fold-change: 0.08846608; Z-score: 1.258369789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.484964117; Fold-change: -0.051303025; Z-score: -0.484960697
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.282589533; Fold-change: 0.019212619; Z-score: 0.163913816
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.704728314; Fold-change: 0.002126187; Z-score: 0.018416327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.015075471; Fold-change: -0.125219153; Z-score: -0.792886659
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.262970082; Fold-change: -0.034425161; Z-score: -0.257830136
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.406178215; Fold-change: 0.006984107; Z-score: 0.060037848
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.674505728; Fold-change: -7.93E-05; Z-score: -0.000896566
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.640351183; Fold-change: 0.018584964; Z-score: 0.132292584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.301976337; Fold-change: -0.035195597; Z-score: -0.196483206
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.391997818; Fold-change: 0.008123346; Z-score: 0.055966226
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.345680809; Fold-change: 0.057831304; Z-score: 0.408509169
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.263646693; Fold-change: 0.057765574; Z-score: 0.422445229
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.561763545; Fold-change: -0.026170429; Z-score: -0.248494151
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.135555058; Fold-change: -0.091703509; Z-score: -0.390532834
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.350130559; Fold-change: -0.060406629; Z-score: -0.201231907
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.825216016; Fold-change: 0.052703839; Z-score: 0.391038801
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.077490782; Fold-change: 0.182109545; Z-score: 2.117402657
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.94718884; Fold-change: 0.02401986; Z-score: 0.191563439
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.252674685; Fold-change: 0.160993287; Z-score: 0.807572964
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.097742588; Fold-change: 0.036208727; Z-score: 0.222054673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.258155829; Fold-change: 0.080821828; Z-score: 0.502476948
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.440865683; Fold-change: 0.012192475; Z-score: 0.03034771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.364937848; Fold-change: 0.002154783; Z-score: 0.020618918
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.460113901; Fold-change: 0.007922694; Z-score: 0.067470873
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.87E-08; Fold-change: -0.295934267; Z-score: -3.015455217
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 09 Disease of the visual system
             [+] ICD-11: 9A96 Anterior uveitis Click to Show/Hide the Full List
The Studied Tissue Peripheral monocyte
The Specified Disease Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.306772868; Fold-change: -0.100825371; Z-score: -1.296926227
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 11 Disease of the circulatory system
             [+] ICD-11: BA41 Myocardial infarction Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.037790049; Fold-change: 0.208714829; Z-score: 0.694590882
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BA80 Coronary artery disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.65848281; Fold-change: -0.029360177; Z-score: -0.227655481
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BB70 Aortic valve stenosis Click to Show/Hide the Full List
The Studied Tissue Calcified aortic valve
The Specified Disease Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.08898291; Fold-change: -0.379198782; Z-score: -0.710860992
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.110325375; Fold-change: -0.120796203; Z-score: -0.696560006
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.076024594; Fold-change: 0.065694338; Z-score: 0.94756111
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.180067322; Fold-change: 0.067078882; Z-score: 0.551900138
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.33871161; Fold-change: 0.024099149; Z-score: 0.134920764
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.042227904; Fold-change: -0.119975187; Z-score: -0.282237218
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.01076945; Fold-change: -0.076188774; Z-score: -0.326715877
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.017849504; Fold-change: -0.601646282; Z-score: -1.468855806
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.542590937; Fold-change: 0.03393483; Z-score: 0.206858327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.70792894; Fold-change: 0.404778315; Z-score: 0.36286153
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.995642318; Fold-change: 0.009808483; Z-score: 0.078235005
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.007664069; Fold-change: 0.574239926; Z-score: 1.477343628
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.718303474; Fold-change: 1.23186612; Z-score: 1.06091436
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.294650359; Fold-change: -0.002213953; Z-score: -0.005254879
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.222968089; Fold-change: -0.100676346; Z-score: -0.737290867
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.30E-08; Fold-change: -0.227848623; Z-score: -0.765431534
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.47E-17; Fold-change: 0.206063282; Z-score: 1.509342422
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.123586748; Fold-change: -0.159104306; Z-score: -0.844380093
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.306017913; Fold-change: -0.12710829; Z-score: -0.63605004
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.579005646; Fold-change: -0.008095572; Z-score: -0.058952366
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.277675806; Fold-change: 0.046718637; Z-score: 0.68614905
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.271704493; Fold-change: -0.02279578; Z-score: -0.100779255
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.046224766; Fold-change: -0.102517148; Z-score: -0.458436882
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001895023; Fold-change: 0.091430719; Z-score: 0.562316685
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.107136201; Fold-change: 0.110370005; Z-score: 0.924458729
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.760131703; Fold-change: 0.326722873; Z-score: 0.619257768
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 16 Disease of the genitourinary system
             [+] ICD-11: GA10 Endometriosis Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00316127; Fold-change: 0.026875246; Z-score: 0.084958638
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: GC00 Cystitis Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.155932457; Fold-change: -0.675271952; Z-score: -1.077544401
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 19 Certain condition originating in the perinatal period
             [+] ICD-11: KA21 Short gestation disorder Click to Show/Hide the Full List
The Studied Tissue Myometrium
The Specified Disease Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.998183383; Fold-change: 0.328304612; Z-score: 0.595330939
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 20 Developmental anomaly
             [+] ICD-11: LD2C Overgrowth syndrome Click to Show/Hide the Full List
The Studied Tissue Adipose tissue
The Specified Disease Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.558872792; Fold-change: 0.049796115; Z-score: 0.726560941
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Perituberal tissue
The Specified Disease Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.468470212; Fold-change: 0.055963304; Z-score: 0.479624177
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
References
1 N-type calcium channel v2.2 is a target of TCF21 in adrenocortical carcinomas. Neoplasma. 2022 Jul;69(4):899-908.
2 Closure of the NCBI SRA and implications for the long-term future of genomics data storage. Genome Biol. 2011;12(3):402.
3 The Encyclopedia of DNA elements (ENCODE): data portal update. Nucleic Acids Res. 2018 Jan 4;46(D1):D794-D801
4 hTFtarget: A Comprehensive Database for Regulations of Human Transcription Factors and Their Targets. Genomics Proteomics Bioinformatics. 2020 Apr;18(2):120-469.
5 NCBI GEO: archive for functional genomics data sets--update. Nucleic Acids Res. 2013 Jan;41(D1):D991-5.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.