Transcription Factor (TF) Information

General Information of This TF
TF ID	TFD0038
TF name	Hepatocyte nuclear factor 3-alpha (FOXA1)
Synonyms	FOXA1; Forkhead box protein A1; HNF-3-alpha; HNF-3A; HNF3A; TCF-3A; TCF3A; Transcription factor 3A
Gene Name	FOXA1
Gene ID	3169
TF Classification	Superclass	Helix-turn-helix domains
	Class	Fork head / winged helix factors
	Family	Forkhead box (FOX) factors
	Subfamily	FOXA
Function	This transcription factor is a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc that modulates the transcriptional activity of nuclear hormone receptors, is involved in ESR1-mediated transcription and regulation of apoptosis by inhibiting the expression of BCL2.
Sequence	MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMT PASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQ AASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLIT MAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGK GSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGA SNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPI SSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAY EQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS
Uniprot ID	FOXA1_HUMAN
Ensembl ID	ENSG00000129514
HGNC ID	HGNC:5021
JASPAR ID	MA0148.1
TF Binding Frequency Matrix

Drug Transporter(s) Regulated by This TF
Activation
ABCC7	Transporter Info	Colon cancer [ICD11: 2B90]	[1]
EAAT1	Transporter Info	Lung cancer [ICD11: 2C25]	[2]
Repression
ASCT2	Transporter Info	Lung cancer [ICD11: 2C25]	[2]
Direct binding
ABCA1	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; prostate	[3]
ABCA2	Transporter Info	ChIP sequencing in breast; liver; prostate	[4]
ABCA4	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate; uterus	[5]
ABCA5	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate; uterus	[6]
ABCB7	Transporter Info	ChIP sequencing in breast; liver; pancreatic ductal; prostate	[3]
ABCB8	Transporter Info	ChIP sequencing in breast; embryo; lung; pancreatic ductal; prostate	[4]
ABCD1	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[6]
ABCD3	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; prostate	[3]
ABCD4	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[4]
ABCG1	Transporter Info	ChIP sequencing in breast; embryo; lung; pancreatic ductal; prostate	[5]
AE2	Transporter Info	ChIP sequencing in breast; liver; pancreatic ductal; prostate	[5]
ANXA11	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[4]
ANXA2	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[6]
ARALAR1	Transporter Info	ChIP sequencing in breast; embryo; liver; prostate	[3]
ARALAR2	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[4]
AST	Transporter Info	ChIP sequencing in breast; embryo; liver; pancreatic ductal; prostate	[4]
ATP10A	Transporter Info	ChIP sequencing in breast; liver; lung; prostate	[5]
ATP2B1	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[6]
ATP7A	Transporter Info	ChIP sequencing in breast; pancreatic ductal; prostate	[4]
CACNA1C	Transporter Info	ChIP sequencing in breast; prostate	[4]
CCC9	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[5]
COPT2	Transporter Info	ChIP sequencing in breast; liver; prostate	[6]
CST	Transporter Info	ChIP sequencing in breast; liver; pancreatic ductal; prostate	[5]
CTL1	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[3]
CTL2	Transporter Info	ChIP sequencing in breast; embryo; liver; prostate	[4]
CTL4	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[5]
CTR1	Transporter Info	ChIP sequencing in breast; liver; pancreatic ductal; prostate	[5]
EAAT2	Transporter Info	ChIP sequencing in breast; embryo; liver; prostate	[5]
ENBT1	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; prostate	[6]
ENT1	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[4]
ENT3	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[5]
FLOT1	Transporter Info	ChIP sequencing in breast; embryo; liver; pancreatic ductal; prostate	[6]
G3PP	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[5]
GC1	Transporter Info	ChIP sequencing in breast	[5]
GC2	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[3]
GDC	Transporter Info	ChIP sequencing in breast; liver; pancreatic ductal; prostate	[5]
GLUT10	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[6]
GLUT12	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[3]
GLUT3	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; prostate	[4]
GLUT4	Transporter Info	ChIP sequencing in breast; liver; lung; prostate	[5]
GLUT5	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[6]
GLUT8	Transporter Info	ChIP sequencing in breast; embryo; liver; pancreatic ductal; prostate	[3]
IREG1	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; prostate	[5]
KCC1	Transporter Info	ChIP sequencing in breast; embryo; prostate	[5]
KCC2	Transporter Info	ChIP sequencing in breast; liver	[6]
KCC3	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[3]
KCC4	Transporter Info	ChIP sequencing in breast; lung; pancreatic ductal; prostate	[4]
KCNJ11	Transporter Info	ChIP sequencing in breast; embryo; lung; prostate	[6]
KCNK4	Transporter Info	ChIP sequencing in breast; prostate	[3]
KCNMA1	Transporter Info	ChIP sequencing in breast; embryo; lung; pancreatic ductal; prostate; uterus	[3]
LAT1	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[5]
LAT2	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; prostate	[4]
LAT3	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[4]
LAT4	Transporter Info	ChIP sequencing in breast; liver; lung; prostate	[5]
MCPHA	Transporter Info	ChIP sequencing in breast; lung; pancreatic ductal; prostate	[4]
MCT4	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate; uterus	[5]
MCT6	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[6]
MCT7	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[3]
MDR3	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; prostate	[6]
MDU1	Transporter Info	ChIP sequencing in breast; liver; lung; prostate	[4]
MFT	Transporter Info	ChIP sequencing in breast; lung; prostate	[4]
MRP1	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[6]
MRP2	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[3]
MRP3	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[5]
MRP5	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[3]
MRP6	Transporter Info	ChIP sequencing in breast; liver; lung; prostate	[4]
NADC3	Transporter Info	ChIP sequencing in breast; embryo; liver; prostate	[6]
NBAT	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[3]
NBC3	Transporter Info	ChIP sequencing in breast; liver; prostate	[3]
NBCe2	Transporter Info	ChIP sequencing in breast; liver; lung; prostate	[6]
NDCBE	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[4]
NPT2C	Transporter Info	ChIP sequencing in breast; liver; prostate	[4]
NRAMP2	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[4]
OATP3A1	Transporter Info	ChIP sequencing in breast; liver; pancreatic ductal; prostate	[3]
OATP4A1	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[4]
OATP5A1	Transporter Info	ChIP sequencing in breast; embryo; lung; pancreatic ductal; prostate	[5]
OCT-1	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[4]
OCTN1	Transporter Info	ChIP sequencing in breast; liver; pancreatic ductal; prostate	[5]
OCTN2	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[6]
OGC	Transporter Info	ChIP sequencing in breast; prostate	[6]
ORNT3	Transporter Info	ChIP sequencing in breast; prostate	[6]
OSTalpha	Transporter Info	ChIP sequencing in breast; liver; prostate	[6]
PAT1	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[6]
PAT3	Transporter Info	ChIP sequencing in breast; embryo; prostate	[3]
PAT4	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[4]
PEPT2	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[5]
PHC	Transporter Info	ChIP sequencing in breast; embryo; liver; prostate	[3]
PHT2	Transporter Info	ChIP sequencing in breast; lung; pancreatic ductal; prostate	[4]
PIT1	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[6]
PIT2	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate; uterus	[3]
PMP34	Transporter Info	ChIP sequencing in breast; embryo; prostate	[6]
RALBP1	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; prostate; uterus	[5]
SAMC	Transporter Info	ChIP sequencing in breast; pancreatic ductal; prostate	[5]
SAT1	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[5]
SCAMC1	Transporter Info	ChIP sequencing in breast; lung; pancreatic ductal; prostate	[3]
SCAMC2	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[4]
SCAMC3	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[6]
SCN8A	Transporter Info	ChIP sequencing in breast; liver; lung; prostate	[3]
SIT1	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[6]
SLC10A7	Transporter Info	ChIP sequencing in breast; embryo; liver; pancreatic ductal; prostate	[6]
SLC11A1	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[3]
SLC17A9	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[5]
SLC22A23	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[4]
SLC23A3	Transporter Info	ChIP sequencing in breast; liver; prostate	[3]
SLC24A1	Transporter Info	ChIP sequencing in breast; embryo; liver; prostate	[4]
SLC24A4	Transporter Info	ChIP sequencing in breast; embryo; lung; pancreatic ductal; prostate	[5]
SLC25A33	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[5]
SLC25A36	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[6]
SLC25A37	Transporter Info	ChIP sequencing in breast; lung; pancreatic ductal; prostate	[3]
SLC25A38	Transporter Info	ChIP sequencing in breast; liver; pancreatic ductal; prostate	[4]
SLC26A6	Transporter Info	ChIP sequencing in breast; embryo; liver	[6]
SLC27A4	Transporter Info	ChIP sequencing in breast; lung; prostate	[3]
SLC2A9	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[4]
SLC33A1	Transporter Info	ChIP sequencing in breast; pancreatic ductal; prostate	[3]
SLC35A2	Transporter Info	ChIP sequencing in breast; embryo; liver; pancreatic ductal; prostate	[6]
SLC35A3	Transporter Info	ChIP sequencing in breast; lung; pancreatic ductal; prostate	[3]
SLC35A4	Transporter Info	ChIP sequencing in breast; pancreatic ductal; prostate	[4]
SLC35A5	Transporter Info	ChIP sequencing in breast; embryo; liver; pancreatic ductal; prostate	[5]
SLC35B1	Transporter Info	ChIP sequencing in breast; liver; pancreatic ductal; prostate	[6]
SLC35B2	Transporter Info	ChIP sequencing in breast	[3]
SLC35B3	Transporter Info	ChIP sequencing in breast; embryo; liver; pancreatic ductal; prostate	[4]
SLC35B4	Transporter Info	ChIP sequencing in breast; liver; prostate	[5]
SLC35D1	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[6]
SLC35D2	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[3]
SLC35E4	Transporter Info	ChIP sequencing in breast; embryo; pancreatic ductal; prostate	[4]
SLC35F6	Transporter Info	ChIP sequencing in breast; lung; pancreatic ductal; prostate	[5]
SLC37A3	Transporter Info	ChIP sequencing in breast; pancreatic ductal; prostate	[6]
SLC38A10	Transporter Info	ChIP sequencing in breast; liver; lung; prostate	[4]
SLC38A11	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[5]
SLC38A9	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[6]
SLC41A1	Transporter Info	ChIP sequencing in breast; prostate	[6]
SLC41A3	Transporter Info	ChIP sequencing in breast; embryo; liver; prostate	[3]
SLC45A4	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[6]
SLC48A1	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate; uterus	[3]
SLC4A11	Transporter Info	ChIP sequencing in breast; liver; lung	[4]
SLC50A1	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[5]
SLC7A11	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[4]
SLC7A6	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[6]
SLC7A7	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[3]
SLC9A1	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate; uterus	[5]
SLC9A8	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[6]
SLC9A9	Transporter Info	ChIP sequencing in breast; embryo; pancreatic ductal; prostate	[3]
SLC9B1	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[4]
SLC9B2	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[5]
SLC9C1	Transporter Info	ChIP sequencing in breast; pancreatic ductal; prostate	[6]
SMIT	Transporter Info	ChIP sequencing in breast; embryo; pancreatic ductal; prostate	[4]
SMIT2	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[3]
SMVT	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[5]
SNAT1	Transporter Info	ChIP sequencing in breast; embryo; lung; prostate	[3]
SNAT2	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[6]
SNAT3	Transporter Info	ChIP sequencing in breast; embryo; liver; prostate	[3]
SNAT6	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[4]
SNAT7	Transporter Info	ChIP sequencing in breast; liver; prostate	[5]
SUT1	Transporter Info	ChIP sequencing in breast; embryo; prostate	[3]
SVCT2	Transporter Info	ChIP sequencing in breast; embryo; liver; pancreatic ductal; prostate	[6]
TAPL	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[5]
TAUT	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[3]
THTR1	Transporter Info	ChIP sequencing in breast; liver; pancreatic ductal; prostate	[3]
THTR2	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate; uterus	[4]
ZIP1	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[3]
ZIP10	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate; uterus	[4]
ZIP11	Transporter Info	ChIP sequencing in breast; liver; lung; pancreatic ductal; prostate	[5]
ZIP13	Transporter Info	ChIP sequencing in breast; prostate	[6]
ZIP5	Transporter Info	ChIP sequencing in breast; prostate	[3]
ZIP7	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[4]
ZIP8	Transporter Info	ChIP sequencing in breast; embryo; lung; pancreatic ductal; prostate	[5]
ZIP9	Transporter Info	ChIP sequencing in breast; liver; pancreatic ductal; prostate	[6]
ZNT1	Transporter Info	ChIP sequencing in breast; embryo; liver; pancreatic ductal; prostate	[5]
ZNT10	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; prostate	[6]
ZNT3	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; prostate	[3]
ZNT4	Transporter Info	ChIP sequencing in breast; pancreatic ductal; prostate	[4]
ZNT5	Transporter Info	ChIP sequencing in breast; embryo; pancreatic ductal; prostate	[5]
ZNT6	Transporter Info	ChIP sequencing in breast; prostate	[6]
ZNT7	Transporter Info	ChIP sequencing in breast; embryo; liver; lung; pancreatic ductal; prostate	[3]
ZNT9	Transporter Info	ChIP sequencing in breast; pancreatic ductal; prostate	[4]

Disease-specific Protein Abundances of TF
ICD-11: 01 Certain infectious or parasitic disease
[+] ICD-11: 1C1H Necrotising ulcerative gingivitis		Click to Show/Hide the Full List
The Studied Tissue	Gingival tissue
The Specified Disease	Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.026023931; Fold-change: 0.018767043; Z-score: 0.147479414
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1E30 Influenza		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.006032768; Fold-change: 0.609799882; Z-score: 5.090894739
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1E51 Chronic viral hepatitis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.208604047; Fold-change: 0.059558545; Z-score: 0.484558352
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1G41 Sepsis with septic shock		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.031316087; Fold-change: 0.015721942; Z-score: 0.104096383
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA40 Respiratory syncytial virus infection		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.46973544; Fold-change: -0.005365982; Z-score: -0.064552319
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA42 Rhinovirus infection		Click to Show/Hide the Full List
The Studied Tissue	Nasal epithelium tissue
The Specified Disease	Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.362513177; Fold-change: 0.007624049; Z-score: 0.032864428
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: KA60 Neonatal sepsis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.099000475; Fold-change: 0.003674142; Z-score: 0.030922421
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 02 Neoplasm
[+] ICD-11: 2A00 Brain cancer		Click to Show/Hide the Full List
The Studied Tissue	Nervous tissue
The Specified Disease	Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.30E-09; Fold-change: 0.040401776; Z-score: 0.135644363
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.629615265; Fold-change: 0.013820435; Z-score: 0.139461217
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	White matter tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.170475507; Fold-change: -0.20600186; Z-score: -0.69115645
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.005259792; Fold-change: -0.05801499; Z-score: -0.282995431
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A20 Myeloproliferative neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.082599465; Fold-change: 0.043745548; Z-score: 0.442378753
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.40E-05; Fold-change: 0.135427992; Z-score: 1.466741561
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A36 Myelodysplastic syndrome		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.165717221; Fold-change: -0.034790852; Z-score: -0.216505439
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.250321248; Fold-change: 0.038751273; Z-score: 0.687719364
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A81 Diffuse large B-cell lymphoma		Click to Show/Hide the Full List
The Studied Tissue	Tonsil tissue
The Specified Disease	Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.036557922; Fold-change: -0.458090801; Z-score: -0.71469201
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A83 Plasma cell neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.721910842; Fold-change: 0.028114185; Z-score: 0.240216844
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Bone marrow
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.143021127; Fold-change: -0.043892358; Z-score: -0.606652772
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B33 Leukaemia		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000100198; Fold-change: 0.016375986; Z-score: 0.174251505
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B6E Oral cancer		Click to Show/Hide the Full List
The Studied Tissue	Oral tissue
The Specified Disease	Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.025038053; Fold-change: 0.110182701; Z-score: 0.271450023
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.135629307; Fold-change: 0.317136353; Z-score: 0.36332962
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B70 Esophageal cancer		Click to Show/Hide the Full List
The Studied Tissue	Esophagus
The Specified Disease	Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.427215986; Fold-change: -0.656433178; Z-score: -0.995107228
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: 2B72 Stomach cancer		Click to Show/Hide the Full List
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.702113712; Fold-change: -1.167111915; Z-score: -0.701041083
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.48E-07; Fold-change: -1.236157236; Z-score: -1.670723413
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B90 Colon cancer		Click to Show/Hide the Full List
The Studied Tissue	Colon tissue
The Specified Disease	Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.12E-66; Fold-change: -1.239828875; Z-score: -2.226889904
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.17E-21; Fold-change: -0.809943032; Z-score: -1.037268816
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B92 Rectal cancer		Click to Show/Hide the Full List
The Studied Tissue	Rectal colon tissue
The Specified Disease	Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002049414; Fold-change: -1.19614611; Z-score: -2.814888567
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.018096327; Fold-change: -1.280401023; Z-score: -1.551071348
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C10 Pancreatic cancer		Click to Show/Hide the Full List
The Studied Tissue	Pancreas
The Specified Disease	Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.93E-06; Fold-change: 0.282070627; Z-score: 0.888839234
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.00123466; Fold-change: 0.401154409; Z-score: 0.509085191
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C12 Liver cancer		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.350244368; Fold-change: -0.164596688; Z-score: -0.220949781
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.819127405; Fold-change: -0.091320953; Z-score: -0.168112746
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.299097166; Fold-change: -0.619193726; Z-score: -0.772347408
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual Download TF expression data in the tissue of the other disease section
[+] ICD-11: 2C25 Lung cancer		Click to Show/Hide the Full List
The Studied Tissue	Lung tissue
The Specified Disease	Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.43E-59; Fold-change: 1.226950943; Z-score: 2.225973609
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.74E-37; Fold-change: 1.214294235; Z-score: 1.9822529
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C30 Skin cancer		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.53E-05; Fold-change: -0.637585562; Z-score: -1.071949656
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Skin
The Specified Disease	Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.39E-48; Fold-change: -0.657060338; Z-score: -1.427408811
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.26E-37; Fold-change: -0.683185967; Z-score: -1.165243704
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C6Z Breast cancer		Click to Show/Hide the Full List
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.14E-28; Fold-change: 2.01400189; Z-score: 1.419249757
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.46E-09; Fold-change: 2.216287796; Z-score: 1.579176699
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C73 Ovarian cancer		Click to Show/Hide the Full List
The Studied Tissue	Ovarian tissue
The Specified Disease	Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.20E-08; Fold-change: -0.098178593; Z-score: -0.901829098
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.217190195; Fold-change: 0.033748999; Z-score: 0.056094226
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C77 Cervical cancer		Click to Show/Hide the Full List
The Studied Tissue	Cervical tissue
The Specified Disease	Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.004751811; Fold-change: 0.894685999; Z-score: 1.213098306
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C78 Uterine cancer		Click to Show/Hide the Full List
The Studied Tissue	Endometrium tissue
The Specified Disease	Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.16E-30; Fold-change: 1.080613687; Z-score: 1.729864295
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.02E-24; Fold-change: 1.270796695; Z-score: 12.50292305
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C82 Prostate cancer		Click to Show/Hide the Full List
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.269680577; Fold-change: -1.062689001; Z-score: -0.735566972
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C90 Renal cancer		Click to Show/Hide the Full List
The Studied Tissue	Kidney
The Specified Disease	Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.651021308; Fold-change: 0.066480515; Z-score: 0.260379253
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.010607947; Fold-change: -0.011900903; Z-score: -0.119650026
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C92 Ureter cancer		Click to Show/Hide the Full List
The Studied Tissue	Urothelium
The Specified Disease	Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.147570171; Fold-change: 0.136374963; Z-score: 0.834942904
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C94 Bladder cancer		Click to Show/Hide the Full List
The Studied Tissue	Bladder tissue
The Specified Disease	Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.003077179; Fold-change: -1.880334499; Z-score: -2.055057357
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D02 Retinal cancer		Click to Show/Hide the Full List
The Studied Tissue	Uvea
The Specified Disease	Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.562437663; Fold-change: 0.039843479; Z-score: 0.650831863
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D10 Thyroid cancer		Click to Show/Hide the Full List
The Studied Tissue	Thyroid
The Specified Disease	Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.51E-06; Fold-change: 0.07604054; Z-score: 0.457841747
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.26E-08; Fold-change: 0.099439055; Z-score: 0.784440207
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D11 Adrenal cancer		Click to Show/Hide the Full List
The Studied Tissue	Adrenal cortex
The Specified Disease	Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.485723006; Fold-change: 0.027505714; Z-score: 0.485791862
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
[+] ICD-11: 2D12 Endocrine gland neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.155740125; Fold-change: -0.222526555; Z-score: -1.042902306
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002437583; Fold-change: -0.368132903; Z-score: -1.528146609
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D42 Head and neck cancer		Click to Show/Hide the Full List
The Studied Tissue	Head and neck tissue
The Specified Disease	Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.83E-19; Fold-change: -2.246075281; Z-score: -1.136092116
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 03 Disease of the blood or blood-forming organs
[+] ICD-11: 3A51 Sickle cell disorder		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.091835447; Fold-change: 0.084265911; Z-score: 0.748874545
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3A70 Aplastic anaemia		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.731633367; Fold-change: 0.081231165; Z-score: 0.46698014
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3B63 Thrombocytosis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.33390529; Fold-change: 0.046513447; Z-score: 0.472909364
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3B64 Thrombocytopenia		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.530263318; Fold-change: 0.07462662; Z-score: 0.88807116
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 04 Disease of the immune system
[+] ICD-11: 4A00 Immunodeficiency		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.282297005; Fold-change: 0.067147609; Z-score: 0.907236505
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A40 Lupus erythematosus		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.492686918; Fold-change: -0.040303274; Z-score: -0.188134307
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A42 Systemic sclerosis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.98762344; Fold-change: -0.02285581; Z-score: -0.127295323
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A43 Systemic autoimmune disease		Click to Show/Hide the Full List
The Studied Tissue	Salivary gland tissue
The Specified Disease	Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.193386052; Fold-change: 0.590745657; Z-score: 1.459425811
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.165587494; Fold-change: 0.442422326; Z-score: 1.206837135
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A62 Behcet disease		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.638990582; Fold-change: -0.003170278; Z-score: -0.02439562
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4B04 Monocyte count disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.580473228; Fold-change: -0.013855813; Z-score: -0.18763446
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 05 Endocrine, nutritional or metabolic disease
[+] ICD-11: 5A11 Type 2 diabetes mellitus		Click to Show/Hide the Full List
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.394868123; Fold-change: 0.011701833; Z-score: 0.165396506
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.672211567; Fold-change: -0.02731141; Z-score: -0.261881884
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Liver tissue
The Specified Disease	Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.038909752; Fold-change: 0.316712704; Z-score: 1.485913227
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5A80 Ovarian dysfunction		Click to Show/Hide the Full List
The Studied Tissue	Vastus lateralis muscle
The Specified Disease	Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.233788945; Fold-change: 0.051511662; Z-score: 1.264464878
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder		Click to Show/Hide the Full List
The Studied Tissue	Biceps muscle
The Specified Disease	Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.566077898; Fold-change: -0.003560828; Z-score: -0.018096398
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C56 Lysosomal disease		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.211471176; Fold-change: 0.024605906; Z-score: 0.283967814
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C80 Hyperlipoproteinaemia		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.092227737; Fold-change: -0.081677891; Z-score: -0.961402464
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.424952081; Fold-change: -0.038700945; Z-score: -0.444464945
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
[+] ICD-11: 6A02 Autism spectrum disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.202487418; Fold-change: 0.04025937; Z-score: 0.296320803
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A20 Schizophrenia		Click to Show/Hide the Full List
The Studied Tissue	Prefrontal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.387805326; Fold-change: 0.005217446; Z-score: 0.049015903
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Superior temporal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.206592911; Fold-change: -0.039688315; Z-score: -0.593848493
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A60 Bipolar disorder		Click to Show/Hide the Full List
The Studied Tissue	Prefrontal cortex
The Specified Disease	Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.280416563; Fold-change: -0.001024764; Z-score: -0.01102857
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A70 Depressive disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.084470759; Fold-change: 0.080883472; Z-score: 0.408832601
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Prefrontal cortex
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.096769595; Fold-change: 0.036186892; Z-score: 0.348777163
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 08 Disease of the nervous system
[+] ICD-11: 8A00 Parkinsonism		Click to Show/Hide the Full List
The Studied Tissue	Substantia nigra tissue
The Specified Disease	Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.045168983; Fold-change: -0.151676219; Z-score: -0.356407684
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A01 Choreiform disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.738736858; Fold-change: -0.012215359; Z-score: -0.161388226
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A20 Alzheimer disease		Click to Show/Hide the Full List
The Studied Tissue	Entorhinal cortex
The Specified Disease	Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.690732686; Fold-change: -0.000823663; Z-score: -0.007975065
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A2Y Neurocognitive impairment		Click to Show/Hide the Full List
The Studied Tissue	White matter tissue
The Specified Disease	HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.154399714; Fold-change: -0.015579763; Z-score: -0.101054103
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A40 Multiple sclerosis		Click to Show/Hide the Full List
The Studied Tissue	Plasmacytoid dendritic cells
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.191809764; Fold-change: 0.169041862; Z-score: 0.768650938
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Spinal cord
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.319002828; Fold-change: -0.075030605; Z-score: -0.373186777
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: 8A60 Epilepsy		Click to Show/Hide the Full List
The Studied Tissue	Peritumoral cortex tissue
The Specified Disease	Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.861059639; Fold-change: 0.0097079; Z-score: 0.188461485
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
The Studied Tissue	Whole blood
The Specified Disease	Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.764110613; Fold-change: -0.057395151; Z-score: -0.436993072
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B01 Subarachnoid haemorrhage		Click to Show/Hide the Full List
The Studied Tissue	Intracranial artery
The Specified Disease	Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.167070111; Fold-change: 0.011098513; Z-score: 0.13664528
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B11 Cerebral ischaemic stroke		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.016239137; Fold-change: 0.07319615; Z-score: 0.620967657
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specified Disease	Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.936437493; Fold-change: -0.027915004; Z-score: -0.31228681
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B60 Motor neuron disease		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001412219; Fold-change: 0.105032107; Z-score: 4.094257416
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.680968061; Fold-change: -0.005667383; Z-score: -0.043645651
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8C70 Muscular dystrophy		Click to Show/Hide the Full List
The Studied Tissue	Muscle tissue
The Specified Disease	Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.821346749; Fold-change: 0.060076933; Z-score: 0.22709729
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8C75 Distal myopathy		Click to Show/Hide the Full List
The Studied Tissue	Muscle tissue
The Specified Disease	Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000268458; Fold-change: -0.121769533; Z-score: -1.389033749
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 09 Disease of the visual system
[+] ICD-11: 9A96 Anterior uveitis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral monocyte
The Specified Disease	Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.119833109; Fold-change: -0.14120702; Z-score: -1.05525826
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 11 Disease of the circulatory system
[+] ICD-11: BA41 Myocardial infarction		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.794006739; Fold-change: 0.044519063; Z-score: 0.134179548
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: BA80 Coronary artery disease		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.551760621; Fold-change: 0.078609434; Z-score: 0.735800907
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: BB70 Aortic valve stenosis		Click to Show/Hide the Full List
The Studied Tissue	Calcified aortic valve
The Specified Disease	Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.872027577; Fold-change: -0.029719619; Z-score: -0.078492714
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 12 Disease of the respiratory system
[+] ICD-11: 7A40 Central sleep apnoea		Click to Show/Hide the Full List
The Studied Tissue	Hyperplastic tonsil
The Specified Disease	Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001771589; Fold-change: 0.821464053; Z-score: 4.976687937
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA08 Vasomotor or allergic rhinitis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.124817346; Fold-change: 0.038685127; Z-score: 1.143110075
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA0A Chronic rhinosinusitis		Click to Show/Hide the Full List
The Studied Tissue	Sinus mucosa tissue
The Specified Disease	Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.604562233; Fold-change: -0.020163406; Z-score: -0.019190309
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA22 Chronic obstructive pulmonary disease		Click to Show/Hide the Full List
The Studied Tissue	Small airway epithelium
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.208899398; Fold-change: -0.045711336; Z-score: -0.115574377
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Lung tissue
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.356503136; Fold-change: -0.066413086; Z-score: -0.17904741
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA23 Asthma		Click to Show/Hide the Full List
The Studied Tissue	Nasal and bronchial airway
The Specified Disease	Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.179721476; Fold-change: -0.308052504; Z-score: -0.348668674
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CB03 Idiopathic interstitial pneumonitis		Click to Show/Hide the Full List
The Studied Tissue	Lung tissue
The Specified Disease	Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.079093483; Fold-change: 0.179004667; Z-score: 0.263288404
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 13 Disease of the digestive system
[+] ICD-11: DA0C Periodontal disease		Click to Show/Hide the Full List
The Studied Tissue	Gingival tissue
The Specified Disease	Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.006597355; Fold-change: 0.047064835; Z-score: 0.36566077
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: DA42 Gastritis		Click to Show/Hide the Full List
The Studied Tissue	Gastric antrum tissue
The Specified Disease	Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.580758406; Fold-change: -0.136298125; Z-score: -0.322347871
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: DB92 Non-alcoholic fatty liver disease		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.034157531; Fold-change: 0.214555707; Z-score: 1.006910193
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: DB99 Hepatic failure		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.41E-07; Fold-change: -2.246325845; Z-score: -3.916568592
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: DD71 Ulcerative colitis		Click to Show/Hide the Full List
The Studied Tissue	Colon mucosal tissue
The Specified Disease	Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.003563405; Fold-change: -0.402392021; Z-score: -0.773204244
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
[+] ICD-11: DD91 Irritable bowel syndrome		Click to Show/Hide the Full List
The Studied Tissue	Rectal colon tissue
The Specified Disease	Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.306691289; Fold-change: -0.070640756; Z-score: -0.307824791
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 14 Disease of the skin
[+] ICD-11: EA80 Atopic eczema		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.022287831; Fold-change: 0.060407667; Z-score: 0.313739996
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: EA90 Psoriasis		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.07E-11; Fold-change: -0.401838934; Z-score: -0.857763827
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.98E-09; Fold-change: -0.360068587; Z-score: -0.858873613
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: ED63 Acquired hypomelanotic disorder		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.505658901; Fold-change: -0.040583477; Z-score: -0.064726958
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: ED70 Alopecia or hair loss		Click to Show/Hide the Full List
The Studied Tissue	Skin from scalp
The Specified Disease	Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00418195; Fold-change: 0.173463467; Z-score: 0.579058879
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: EK0Z Contact dermatitis		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.058544197; Fold-change: -0.192314002; Z-score: -0.874695047
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
[+] ICD-11: FA00 Osteoarthritis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.400159281; Fold-change: 0.048602356; Z-score: 0.569225583
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.529768467; Fold-change: -0.040171516; Z-score: -0.152297391
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA20 Rheumatoid arthritis		Click to Show/Hide the Full List
The Studied Tissue	Synovial tissue
The Specified Disease	Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.071821873; Fold-change: -0.336734795; Z-score: -0.782291907
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA24 Juvenile idiopathic arthritis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.177598259; Fold-change: 0.006807433; Z-score: 0.026133632
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA92 Inflammatory spondyloarthritis		Click to Show/Hide the Full List
The Studied Tissue	Pheripheral blood
The Specified Disease	Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.671808595; Fold-change: -0.056202017; Z-score: -0.733364175
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FB83 Low bone mass disorder		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.028103809; Fold-change: 0.207242454; Z-score: 4.812555542
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 16 Disease of the genitourinary system
[+] ICD-11: GA10 Endometriosis		Click to Show/Hide the Full List
The Studied Tissue	Endometrium tissue
The Specified Disease	Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.96541497; Fold-change: 0.005697277; Z-score: 0.038441075
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: GC00 Cystitis		Click to Show/Hide the Full List
The Studied Tissue	Bladder tissue
The Specified Disease	Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000154784; Fold-change: -2.833257202; Z-score: -5.944189893
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 19 Certain condition originating in the perinatal period
[+] ICD-11: KA21 Short gestation disorder		Click to Show/Hide the Full List
The Studied Tissue	Myometrium
The Specified Disease	Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.402257679; Fold-change: -0.037817065; Z-score: -0.286894852
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 20 Developmental anomaly
[+] ICD-11: LD2C Overgrowth syndrome		Click to Show/Hide the Full List
The Studied Tissue	Adipose tissue
The Specified Disease	Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.794747043; Fold-change: -0.04796508; Z-score: -2.311170385
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome		Click to Show/Hide the Full List
The Studied Tissue	Perituberal tissue
The Specified Disease	Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.008412116; Fold-change: 0.103015332; Z-score: 2.46380319
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual

References
1	Chromatin remodeling mediated by the FOXA1/A2 transcription factors activates CFTR expression in intestinal epithelial cells. Epigenetics. 2014 Apr;9(4):557-65.
2	Targeted metabolomics analysis identified the role of FOXA1 in the change in glutamate-glutamine metabolic pattern of BaP malignantly transformed 16HBE cells. Toxicol Appl Pharmacol. 2023 Feb 15;461:116402.
3	Closure of the NCBI SRA and implications for the long-term future of genomics data storage. Genome Biol. 2011;12(3):402.
4	The Encyclopedia of DNA elements (ENCODE): data portal update. Nucleic Acids Res. 2018 Jan 4;46(D1):D794-D801
5	hTFtarget: A Comprehensive Database for Regulations of Human Transcription Factors and Their Targets. Genomics Proteomics Bioinformatics. 2020 Apr;18(2):120-469.
6	NCBI GEO: archive for functional genomics data sets--update. Nucleic Acids Res. 2013 Jan;41(D1):D991-5.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

Transcription Factor (TF) Information

Visitor Map

Correspondence