Transcription Factor (TF) Information

General Information of This TF
TF ID	TFD0023
TF name	Transcriptional repressor CTCF (CTCF)
Synonyms	11-zinc finger protein; CCCTC-binding factor; CTCF; CTCFL paralog
Gene Name	CTCF
Gene ID	10664
TF Classification	Superclass	Zinc-coordinating DNA-binding domains
	Class	C2H2 zinc finger factors
	Family	More than 3 adjacent zinc finger factors
	Subfamily	CTCF-like factors
Function	This transcription factor is a transcriptional activator of APP. It is involved in transcriptional regulation by binding to chromatin insulators and preventing interaction between promoter and nearby enhancers and silencers.
Sequence	MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQM VMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPV PVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQ GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEV NAEKVVGNMKPPKPTKIKKKGVKKTFQCELCSYTCPRRSNLDRHMKSHTDERPHKCHLCG RAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYAS VEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSG TMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERY ALIQHQKSHKNEKRFKCDQCDYACRQERHMIMHKRTHTGEKPYACSHCDKTFRQKQLLDM HFKRYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCAGPDGVEGENGGETKKSKRGRKR KMRSKKEDSSDSENAEPDLDDNEDEEEPAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTN QPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQPAATDAPNGDLTPEM ILSMMDR
Uniprot ID	CTCF_HUMAN
Ensembl ID	ENSG00000102974
HGNC ID	HGNC:13723
JASPAR ID	MA0139.1
TF Binding Frequency Matrix

Drug Transporter(s) Regulated by This TF
Activation
SERT	Transporter Info	Gestational choriocarcinoma [ICD11: 2C75]	[1]
Direct binding
ABCA10	Transporter Info	ChIP sequencing in brain	[2]
ABCA2	Transporter Info	ChIP sequencing in brain	[3]
ABCA3	Transporter Info	ChIP sequencing in brain	[4]
ABCA5	Transporter Info	ChIP sequencing in brain	[5]
ABCA6	Transporter Info	ChIP sequencing in brain	[2]
ABCA7	Transporter Info	ChIP sequencing in brain	[3]
ABCA8	Transporter Info	ChIP sequencing in brain	[4]
ABCB5	Transporter Info	ChIP sequencing in brain	[5]
ABCB6	Transporter Info	ChIP sequencing in brain	[2]
ABCB8	Transporter Info	ChIP sequencing in brain	[3]
ABCD1	Transporter Info	ChIP sequencing in brain	[4]
ABCD3	Transporter Info	ChIP sequencing in brain	[5]
ABCD4	Transporter Info	ChIP sequencing in brain	[2]
AE2	Transporter Info	ChIP sequencing in brain	[3]
AE3	Transporter Info	ChIP sequencing in brain	[4]
AE4	Transporter Info	ChIP sequencing in brain	[3]
ANXA11	Transporter Info	ChIP sequencing in brain	[3]
ARALAR1	Transporter Info	ChIP sequencing in brain	[2]
ASC1	Transporter Info	ChIP sequencing in brain	[2]
ASCT1	Transporter Info	ChIP sequencing in brain	[3]
ASCT2	Transporter Info	ChIP sequencing in brain	[4]
AST	Transporter Info	ChIP sequencing in brain	[3]
ATP10A	Transporter Info	ChIP sequencing in brain	[4]
ATP12A	Transporter Info	ChIP sequencing in brain	[5]
ATP2B1	Transporter Info	ChIP sequencing in brain	[5]
ATP7A	Transporter Info	ChIP sequencing in brain	[5]
ATP7B	Transporter Info	ChIP sequencing in brain	[2]
BGT1	Transporter Info	ChIP sequencing in brain	[5]
CACNA1C	Transporter Info	ChIP sequencing in brain	[3]
CACNA1G	Transporter Info	ChIP sequencing in brain	[2]
CACNA1H	Transporter Info	ChIP sequencing in brain	[5]
CAT1	Transporter Info	ChIP sequencing in striated muscle	[5]
CCC9	Transporter Info	ChIP sequencing in brain	[4]
CNT1	Transporter Info	ChIP sequencing in brain	[3]
COPT2	Transporter Info	ChIP sequencing in brain	[3]
CTL1	Transporter Info	ChIP sequencing in striated muscle	[5]
CTL2	Transporter Info	ChIP sequencing in striated muscle	[2]
CTL4	Transporter Info	ChIP sequencing in brain	[3]
DIC	Transporter Info	ChIP sequencing in brain	[4]
EAAT1	Transporter Info	ChIP sequencing in striated muscle	[2]
ENT1	Transporter Info	ChIP sequencing in brain	[4]
ENT2	Transporter Info	ChIP sequencing in brain	[5]
ENT3	Transporter Info	ChIP sequencing in brain	[2]
ENT4	Transporter Info	ChIP sequencing in brain	[3]
FATP1	Transporter Info	ChIP sequencing in brain	[3]
FLOT1	Transporter Info	ChIP sequencing in brain	[4]
FUCT1	Transporter Info	ChIP sequencing in brain	[2]
G3PP	Transporter Info	ChIP sequencing in brain	[3]
G6PT	Transporter Info	ChIP sequencing in brain	[2]
GAT2	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; colon; embryo; epithelium; liver	[2]
GC1	Transporter Info	ChIP sequencing in brain	[2]
GLUT14	Transporter Info	ChIP sequencing in brain	[2]
GLUT3	Transporter Info	ChIP sequencing in brain	[3]
GLUT4	Transporter Info	ChIP sequencing in brain	[4]
GLUT5	Transporter Info	ChIP sequencing in striated muscle	[5]
GLUT6	Transporter Info	ChIP sequencing in brain	[2]
GLUT8	Transporter Info	ChIP sequencing in brain	[3]
GLYT1	Transporter Info	ChIP sequencing in brain	[4]
KCC2	Transporter Info	ChIP sequencing in brain	[2]
KCC3	Transporter Info	ChIP sequencing in brain	[3]
KCNH2	Transporter Info	ChIP sequencing in brain	[4]
KCNJ11	Transporter Info	ChIP sequencing in brain	[5]
KCNK4	Transporter Info	ChIP sequencing in brain	[4]
KCNMA1	Transporter Info	ChIP sequencing in brain	[2]
KCNN1	Transporter Info	ChIP sequencing in brain	[3]
LAT1	Transporter Info	ChIP sequencing in brain	[3]
LAT2	Transporter Info	ChIP sequencing in striated muscle	[2]
LAT3	Transporter Info	ChIP sequencing in brain	[3]
LAT4	Transporter Info	ChIP sequencing in brain	[4]
MATE2	Transporter Info	ChIP sequencing in brain	[4]
MCPHA	Transporter Info	ChIP sequencing in brain	[5]
MCT1	Transporter Info	ChIP sequencing in brain	[2]
MCT2	Transporter Info	ChIP sequencing in brain	[4]
MCT3	Transporter Info	ChIP sequencing in skin	[5]
MCT4	Transporter Info	ChIP sequencing in brain	[2]
MCT7	Transporter Info	ChIP sequencing in brain	[3]
MCT9	Transporter Info	ChIP sequencing in brain	[2]
MDU1	Transporter Info	ChIP sequencing in brain	[3]
MRP1	Transporter Info	ChIP sequencing in striated muscle	[4]
MRP3	Transporter Info	ChIP sequencing in brain	[2]
MRP4	Transporter Info	ChIP sequencing in brain	[3]
MRP5	Transporter Info	ChIP sequencing in brain	[4]
MRP6	Transporter Info	ChIP sequencing in brain	[5]
MRP7	Transporter Info	ChIP sequencing in brain	[5]
MRP8	Transporter Info	ChIP sequencing in brain	[2]
NADC3	Transporter Info	ChIP sequencing in brain	[5]
NBAT	Transporter Info	ChIP sequencing in brain	[2]
NBCe2	Transporter Info	ChIP sequencing in brain	[5]
NCC	Transporter Info	ChIP sequencing in brain	[5]
NDCBE	Transporter Info	ChIP sequencing in brain	[2]
NIS	Transporter Info	ChIP sequencing in brain	[3]
NKCC1	Transporter Info	ChIP sequencing in brain	[4]
NPT2A	Transporter Info	ChIP sequencing in brain	[5]
NPT2C	Transporter Info	ChIP sequencing in brain	[2]
NRAMP2	Transporter Info	ChIP sequencing in brain	[3]
OAT4	Transporter Info	ChIP sequencing in brain	[3]
OAT6	Transporter Info	ChIP sequencing in brain	[4]
OATP2A1	Transporter Info	ChIP sequencing in striated muscle	[4]
OATP2B1	Transporter Info	ChIP sequencing in brain	[5]
OATP3A1	Transporter Info	ChIP sequencing in brain	[5]
OATP4A1	Transporter Info	ChIP sequencing in brain	[2]
OATP4C1	Transporter Info	ChIP sequencing in brain	[3]
OCT-1	Transporter Info	ChIP sequencing in striated muscle	[5]
OCTN1	Transporter Info	ChIP sequencing in brain	[2]
OCTN2	Transporter Info	ChIP sequencing in brain	[2]
OGC	Transporter Info	ChIP sequencing in striated muscle	[5]
ORNT3	Transporter Info	ChIP sequencing in brain	[5]
OSTbeta	Transporter Info	ChIP sequencing in blood; breast	[5]
PAT1	Transporter Info	ChIP sequencing in brain	[2]
PHT2	Transporter Info	ChIP sequencing in brain	[4]
PIT1	Transporter Info	ChIP sequencing in brain	[5]
PIT2	Transporter Info	ChIP sequencing in brain	[2]
PMP34	Transporter Info	ChIP sequencing in brain	[4]
PTR4	Transporter Info	ChIP sequencing in brain	[5]
RALBP1	Transporter Info	ChIP sequencing in brain	[4]
RFVT1	Transporter Info	ChIP sequencing in skin	[2]
RFVT2	Transporter Info	ChIP sequencing in brain	[3]
SAMC	Transporter Info	ChIP sequencing in brain	[2]
SAT1	Transporter Info	ChIP sequencing in brain	[3]
SCAMC1	Transporter Info	ChIP sequencing in brain	[4]
SCAMC2	Transporter Info	ChIP sequencing in brain	[5]
SCAMC3	Transporter Info	ChIP sequencing in brain	[3]
SCN1A	Transporter Info	ChIP sequencing in brain	[2]
SCN4A	Transporter Info	ChIP sequencing in brain	[3]
SCN8A	Transporter Info	ChIP sequencing in brain	[4]
SGLT2	Transporter Info	ChIP sequencing in brain	[5]
SGLT5	Transporter Info	ChIP sequencing in brain	[4]
SLC16A11	Transporter Info	ChIP sequencing in brain	[3]
SLC16A13	Transporter Info	ChIP sequencing in skin	[4]
SLC16A14	Transporter Info	ChIP sequencing in brain	[5]
SLC17A9	Transporter Info	ChIP sequencing in brain	[5]
SLC18B1	Transporter Info	ChIP sequencing in brain	[3]
SLC22A17	Transporter Info	ChIP sequencing in brain	[3]
SLC22A23	Transporter Info	ChIP sequencing in brain	[5]
SLC23A3	Transporter Info	ChIP sequencing in brain	[4]
SLC24A1	Transporter Info	ChIP sequencing in brain	[5]
SLC24A3	Transporter Info	ChIP sequencing in brain	[2]
SLC25A1	Transporter Info	ChIP sequencing in brain	[3]
SLC25A15	Transporter Info	ChIP sequencing in brain	[3]
SLC25A27	Transporter Info	ChIP sequencing in brain	[3]
SLC25A28	Transporter Info	ChIP sequencing in brain	[4]
SLC25A37	Transporter Info	ChIP sequencing in brain	[2]
SLC25A38	Transporter Info	ChIP sequencing in brain	[3]
SLC25A4	Transporter Info	ChIP sequencing in brain	[4]
SLC25A42	Transporter Info	ChIP sequencing in brain	[5]
SLC25A5	Transporter Info	ChIP sequencing in brain	[2]
SLC26A2	Transporter Info	ChIP sequencing in brain	[4]
SLC26A6	Transporter Info	ChIP sequencing in brain	[5]
SLC26A9	Transporter Info	ChIP sequencing in brain	[2]
SLC27A3	Transporter Info	ChIP sequencing in brain	[4]
SLC27A4	Transporter Info	ChIP sequencing in brain	[5]
SLC27A5	Transporter Info	ChIP sequencing in brain	[2]
SLC2A11	Transporter Info	ChIP sequencing in brain	[4]
SLC2A13	Transporter Info	ChIP sequencing in brain	[5]
SLC2A9	Transporter Info	ChIP sequencing in brain	[4]
SLC33A1	Transporter Info	ChIP sequencing in brain	[4]
SLC35A2	Transporter Info	ChIP sequencing in brain	[3]
SLC35B1	Transporter Info	ChIP sequencing in brain	[4]
SLC35B2	Transporter Info	ChIP sequencing in brain	[5]
SLC35D2	Transporter Info	ChIP sequencing in brain	[3]
SLC35E4	Transporter Info	ChIP sequencing in brain	[4]
SLC35F6	Transporter Info	ChIP sequencing in brain	[5]
SLC37A2	Transporter Info	ChIP sequencing in brain	[4]
SLC37A3	Transporter Info	ChIP sequencing in brain	[5]
SLC38A10	Transporter Info	ChIP sequencing in brain	[3]
SLC38A11	Transporter Info	ChIP sequencing in striated muscle	[4]
SLC38A8	Transporter Info	ChIP sequencing in brain	[5]
SLC38A9	Transporter Info	ChIP sequencing in brain	[2]
SLC41A1	Transporter Info	ChIP sequencing in brain	[4]
SLC41A2	Transporter Info	ChIP sequencing in brain	[5]
SLC41A3	Transporter Info	ChIP sequencing in brain	[2]
SLC45A4	Transporter Info	ChIP sequencing in brain	[4]
SLC46A2	Transporter Info	ChIP sequencing in brain	[5]
SLC48A1	Transporter Info	ChIP sequencing in brain	[2]
SLC50A1	Transporter Info	ChIP sequencing in striated muscle	[4]
SLC7A6	Transporter Info	ChIP sequencing in brain	[4]
SLC7A7	Transporter Info	ChIP sequencing in brain	[5]
SLC8A2	Transporter Info	ChIP sequencing in brain	[3]
SLC8B1	Transporter Info	ChIP sequencing in brain	[4]
SLC9A1	Transporter Info	ChIP sequencing in brain	[5]
SLC9A5	Transporter Info	ChIP sequencing in brain	[2]
SLC9A7	Transporter Info	ChIP sequencing in brain	[3]
SLC9A8	Transporter Info	ChIP sequencing in brain	[4]
SLC9B1	Transporter Info	ChIP sequencing in brain	[5]
SLC9B2	Transporter Info	ChIP sequencing in brain	[2]
SLC9C1	Transporter Info	ChIP sequencing in brain	[3]
SMIT	Transporter Info	ChIP sequencing in brain	[2]
SMVT	Transporter Info	ChIP sequencing in brain	[4]
SNAT2	Transporter Info	ChIP sequencing in brain	[5]
SNAT3	Transporter Info	ChIP sequencing in brain	[2]
SNAT5	Transporter Info	ChIP sequencing in brain	[3]
SNAT7	Transporter Info	ChIP sequencing in striated muscle	[4]
SUR1	Transporter Info	ChIP sequencing in brain	[3]
SUT1	Transporter Info	ChIP sequencing in brain	[2]
SVCT1	Transporter Info	ChIP sequencing in brain	[3]
TAPL	Transporter Info	ChIP sequencing in brain	[4]
TAUT	Transporter Info	ChIP sequencing in brain	[3]
THTR1	Transporter Info	ChIP sequencing in brain	[5]
UT1	Transporter Info	ChIP sequencing in brain	[3]
VGLUT1	Transporter Info	ChIP sequencing in brain	[4]
VMAT1	Transporter Info	ChIP sequencing in brain	[2]
ZIP1	Transporter Info	ChIP sequencing in brain	[3]
ZIP10	Transporter Info	ChIP sequencing in brain	[4]
ZIP11	Transporter Info	ChIP sequencing in brain	[5]
ZIP13	Transporter Info	ChIP sequencing in brain	[2]
ZIP14	Transporter Info	ChIP sequencing in brain	[3]
ZIP2	Transporter Info	ChIP sequencing in brain	[4]
ZIP3	Transporter Info	ChIP sequencing in striated muscle	[5]
ZIP4	Transporter Info	ChIP sequencing in brain	[2]
ZIP5	Transporter Info	ChIP sequencing in brain	[3]
ZIP7	Transporter Info	ChIP sequencing in brain	[4]
ZIP8	Transporter Info	ChIP sequencing in brain	[5]
ZNT1	Transporter Info	ChIP sequencing in brain	[5]
ZNT2	Transporter Info	ChIP sequencing in brain	[2]
ZNT3	Transporter Info	ChIP sequencing in brain	[3]
ZNT4	Transporter Info	ChIP sequencing in brain	[4]
ZNT5	Transporter Info	ChIP sequencing in brain	[5]
ZNT9	Transporter Info	ChIP sequencing in brain	[2]

Disease-specific Protein Abundances of TF
ICD-11: 01 Certain infectious or parasitic disease
[+] ICD-11: 1C1H Necrotising ulcerative gingivitis		Click to Show/Hide the Full List
The Studied Tissue	Gingival tissue
The Specified Disease	Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.46820244; Fold-change: -0.0303209; Z-score: -0.105868226
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1E30 Influenza		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.027150033; Fold-change: -0.994816431; Z-score: -2.341040723
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1E51 Chronic viral hepatitis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.25074422; Fold-change: -0.010635456; Z-score: -0.065345228
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1G41 Sepsis with septic shock		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.01E-22; Fold-change: -0.283305082; Z-score: -0.767581871
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA40 Respiratory syncytial virus infection		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.49E-05; Fold-change: -0.185667414; Z-score: -1.256818735
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA42 Rhinovirus infection		Click to Show/Hide the Full List
The Studied Tissue	Nasal epithelium tissue
The Specified Disease	Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.612342553; Fold-change: -0.006492571; Z-score: -0.044993064
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: KA60 Neonatal sepsis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.20782257; Fold-change: -0.036393449; Z-score: -0.077139631
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 02 Neoplasm
[+] ICD-11: 2A00 Brain cancer		Click to Show/Hide the Full List
The Studied Tissue	Nervous tissue
The Specified Disease	Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.65E-49; Fold-change: 0.392759665; Z-score: 0.988902518
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.635857751; Fold-change: -0.114614694; Z-score: -0.507243544
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	White matter tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.184804179; Fold-change: 0.176085506; Z-score: 0.710164194
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.51E-07; Fold-change: 1.77082218; Z-score: 3.802283297
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A20 Myeloproliferative neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.035739034; Fold-change: -0.31493192; Z-score: -1.640727847
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.32E-09; Fold-change: -0.351066671; Z-score: -1.718720618
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A36 Myelodysplastic syndrome		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.01497506; Fold-change: -0.308180338; Z-score: -0.703693278
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.123744033; Fold-change: -0.196135718; Z-score: -1.050384975
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A81 Diffuse large B-cell lymphoma		Click to Show/Hide the Full List
The Studied Tissue	Tonsil tissue
The Specified Disease	Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.648880767; Fold-change: 0.143765082; Z-score: 0.470785483
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A83 Plasma cell neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.634794353; Fold-change: -0.050658515; Z-score: -0.227350427
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Bone marrow
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.13E-05; Fold-change: 0.54827759; Z-score: 2.820490222
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B33 Leukaemia		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.036527148; Fold-change: -0.128715471; Z-score: -0.505459496
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B6E Oral cancer		Click to Show/Hide the Full List
The Studied Tissue	Oral tissue
The Specified Disease	Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001041587; Fold-change: 0.477226281; Z-score: 1.055395239
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.432238545; Fold-change: 0.074128556; Z-score: 0.17841547
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B70 Esophageal cancer		Click to Show/Hide the Full List
The Studied Tissue	Esophagus
The Specified Disease	Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.032733896; Fold-change: 0.152140551; Z-score: 0.746994239
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: 2B72 Stomach cancer		Click to Show/Hide the Full List
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.097710562; Fold-change: 0.343300499; Z-score: 1.345369575
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.020337767; Fold-change: 0.069059306; Z-score: 0.52712706
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B90 Colon cancer		Click to Show/Hide the Full List
The Studied Tissue	Colon tissue
The Specified Disease	Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.092075896; Fold-change: -0.028141297; Z-score: -0.123423078
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.630980564; Fold-change: 0.057872872; Z-score: 0.178034319
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B92 Rectal cancer		Click to Show/Hide the Full List
The Studied Tissue	Rectal colon tissue
The Specified Disease	Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.902698213; Fold-change: -0.05355913; Z-score: -0.25364876
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.118824901; Fold-change: -0.183028306; Z-score: -0.960383786
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C10 Pancreatic cancer		Click to Show/Hide the Full List
The Studied Tissue	Pancreas
The Specified Disease	Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.008602886; Fold-change: 0.680060527; Z-score: 1.288737913
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.73E-07; Fold-change: 0.392501649; Z-score: 0.739390167
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C12 Liver cancer		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.20E-09; Fold-change: 0.275967699; Z-score: 1.031557486
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.08E-09; Fold-change: 0.143931373; Z-score: 0.591560521
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.611174815; Fold-change: -0.041920566; Z-score: -0.270535869
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual Download TF expression data in the tissue of the other disease section
[+] ICD-11: 2C25 Lung cancer		Click to Show/Hide the Full List
The Studied Tissue	Lung tissue
The Specified Disease	Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.84E-18; Fold-change: 0.199922876; Z-score: 0.765600705
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.30E-13; Fold-change: 0.304305641; Z-score: 0.952575429
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C30 Skin cancer		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.810212274; Fold-change: -0.234045465; Z-score: -0.379988075
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Skin
The Specified Disease	Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.02909348; Fold-change: 0.064896992; Z-score: 0.153046731
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.32E-22; Fold-change: -0.893182259; Z-score: -1.582599337
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C6Z Breast cancer		Click to Show/Hide the Full List
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00072863; Fold-change: 0.120590026; Z-score: 0.312951743
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.25040431; Fold-change: 0.072845181; Z-score: 0.164190743
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C73 Ovarian cancer		Click to Show/Hide the Full List
The Studied Tissue	Ovarian tissue
The Specified Disease	Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.342224125; Fold-change: -0.07380941; Z-score: -0.151705672
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.512495064; Fold-change: 0.009532355; Z-score: 0.061565136
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C77 Cervical cancer		Click to Show/Hide the Full List
The Studied Tissue	Cervical tissue
The Specified Disease	Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.045716018; Fold-change: 0.20044749; Z-score: 0.656293932
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C78 Uterine cancer		Click to Show/Hide the Full List
The Studied Tissue	Endometrium tissue
The Specified Disease	Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.118380348; Fold-change: 0.05571874; Z-score: 0.128148898
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.796027056; Fold-change: 0.05640141; Z-score: 0.337193729
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C82 Prostate cancer		Click to Show/Hide the Full List
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.005310034; Fold-change: 0.915000599; Z-score: 1.273160715
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C90 Renal cancer		Click to Show/Hide the Full List
The Studied Tissue	Kidney
The Specified Disease	Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.266799278; Fold-change: 0.364072375; Z-score: 0.557760271
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.66E-22; Fold-change: 0.76515639; Z-score: 2.001121737
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C92 Ureter cancer		Click to Show/Hide the Full List
The Studied Tissue	Urothelium
The Specified Disease	Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.400518617; Fold-change: 0.035106949; Z-score: 0.112105466
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C94 Bladder cancer		Click to Show/Hide the Full List
The Studied Tissue	Bladder tissue
The Specified Disease	Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.11E-08; Fold-change: -0.519351305; Z-score: -4.000571045
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D02 Retinal cancer		Click to Show/Hide the Full List
The Studied Tissue	Uvea
The Specified Disease	Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.052741; Fold-change: 0.224535504; Z-score: 1.046064059
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D10 Thyroid cancer		Click to Show/Hide the Full List
The Studied Tissue	Thyroid
The Specified Disease	Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.96E-18; Fold-change: -0.252944724; Z-score: -1.032117833
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.010559727; Fold-change: -0.055815878; Z-score: -0.286053924
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D11 Adrenal cancer		Click to Show/Hide the Full List
The Studied Tissue	Adrenal cortex
The Specified Disease	Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 9.55E-06; Fold-change: 0.396956983; Z-score: 1.443673277
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
[+] ICD-11: 2D12 Endocrine gland neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.022674537; Fold-change: 0.447799242; Z-score: 0.819219342
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001034776; Fold-change: 0.614737895; Z-score: 1.570343527
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D42 Head and neck cancer		Click to Show/Hide the Full List
The Studied Tissue	Head and neck tissue
The Specified Disease	Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.285672483; Fold-change: -0.017245974; Z-score: -0.066326253
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 03 Disease of the blood or blood-forming organs
[+] ICD-11: 3A51 Sickle cell disorder		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.133942528; Fold-change: -0.219853866; Z-score: -0.369088224
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3A70 Aplastic anaemia		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.125406133; Fold-change: -0.269750863; Z-score: -0.76170721
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3B63 Thrombocytosis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.006409105; Fold-change: -0.246202358; Z-score: -1.25015147
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3B64 Thrombocytopenia		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.124313965; Fold-change: -0.609795648; Z-score: -1.130010464
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 04 Disease of the immune system
[+] ICD-11: 4A00 Immunodeficiency		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.468738287; Fold-change: 0.1138447; Z-score: 0.683003171
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A40 Lupus erythematosus		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.933177214; Fold-change: 0.036680418; Z-score: 0.043944262
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A42 Systemic sclerosis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.59E-05; Fold-change: -0.303551595; Z-score: -1.986643731
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A43 Systemic autoimmune disease		Click to Show/Hide the Full List
The Studied Tissue	Salivary gland tissue
The Specified Disease	Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.179102064; Fold-change: 0.489966224; Z-score: 1.203216578
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.010595046; Fold-change: 0.461353701; Z-score: 2.366139558
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A62 Behcet disease		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.701571901; Fold-change: -0.035576388; Z-score: -0.187684649
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4B04 Monocyte count disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.063892436; Fold-change: -1.029771875; Z-score: -1.482134982
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 05 Endocrine, nutritional or metabolic disease
[+] ICD-11: 5A11 Type 2 diabetes mellitus		Click to Show/Hide the Full List
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.003555189; Fold-change: -0.407542341; Z-score: -2.087109741
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.903545905; Fold-change: 0.00041167; Z-score: 0.004005655
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Liver tissue
The Specified Disease	Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.205915901; Fold-change: 0.218783318; Z-score: 0.991048177
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5A80 Ovarian dysfunction		Click to Show/Hide the Full List
The Studied Tissue	Vastus lateralis muscle
The Specified Disease	Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.202369292; Fold-change: 0.090118376; Z-score: 0.309584982
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder		Click to Show/Hide the Full List
The Studied Tissue	Biceps muscle
The Specified Disease	Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.00E-05; Fold-change: -0.31166676; Z-score: -3.048976861
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C56 Lysosomal disease		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.657386038; Fold-change: -0.068465112; Z-score: -0.80626786
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C80 Hyperlipoproteinaemia		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.077187411; Fold-change: 0.076988331; Z-score: 0.482136775
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.54E-06; Fold-change: 0.275764462; Z-score: 0.906182168
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
[+] ICD-11: 6A02 Autism spectrum disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.020942385; Fold-change: 0.191960069; Z-score: 0.719781831
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A20 Schizophrenia		Click to Show/Hide the Full List
The Studied Tissue	Prefrontal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.865385785; Fold-change: 0.021433244; Z-score: 0.040335051
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Superior temporal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.797010942; Fold-change: -0.022494982; Z-score: -0.166304931
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A60 Bipolar disorder		Click to Show/Hide the Full List
The Studied Tissue	Prefrontal cortex
The Specified Disease	Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.320511594; Fold-change: 0.007149281; Z-score: 0.039176058
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A70 Depressive disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.56764443; Fold-change: -0.000537312; Z-score: -0.004457864
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Prefrontal cortex
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.697206831; Fold-change: 0.043180675; Z-score: 0.23591267
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 08 Disease of the nervous system
[+] ICD-11: 8A00 Parkinsonism		Click to Show/Hide the Full List
The Studied Tissue	Substantia nigra tissue
The Specified Disease	Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000282482; Fold-change: 0.250803904; Z-score: 1.427898606
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A01 Choreiform disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.524783489; Fold-change: -0.03080533; Z-score: -0.128582209
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A20 Alzheimer disease		Click to Show/Hide the Full List
The Studied Tissue	Entorhinal cortex
The Specified Disease	Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00017362; Fold-change: 0.10677502; Z-score: 0.518853528
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A2Y Neurocognitive impairment		Click to Show/Hide the Full List
The Studied Tissue	White matter tissue
The Specified Disease	HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.22230273; Fold-change: 0.074303312; Z-score: 0.174891177
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A40 Multiple sclerosis		Click to Show/Hide the Full List
The Studied Tissue	Plasmacytoid dendritic cells
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.451598041; Fold-change: -0.031487403; Z-score: -0.149042462
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Spinal cord
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.704776509; Fold-change: 0.041796129; Z-score: 0.11950986
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: 8A60 Epilepsy		Click to Show/Hide the Full List
The Studied Tissue	Peritumoral cortex tissue
The Specified Disease	Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.298152263; Fold-change: 0.057401274; Z-score: 0.231475678
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
The Studied Tissue	Whole blood
The Specified Disease	Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.063723509; Fold-change: -0.330562073; Z-score: -0.915530042
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B01 Subarachnoid haemorrhage		Click to Show/Hide the Full List
The Studied Tissue	Intracranial artery
The Specified Disease	Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.100779297; Fold-change: -0.221549669; Z-score: -0.602937512
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B11 Cerebral ischaemic stroke		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.66E-15; Fold-change: -0.308533818; Z-score: -2.723501845
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specified Disease	Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.251506011; Fold-change: -0.144807345; Z-score: -0.696695774
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B60 Motor neuron disease		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.227584136; Fold-change: 0.260108961; Z-score: 1.078265587
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.69940283; Fold-change: 0.049859438; Z-score: 0.141335023
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8C70 Muscular dystrophy		Click to Show/Hide the Full List
The Studied Tissue	Muscle tissue
The Specified Disease	Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.07822991; Fold-change: -0.094989702; Z-score: -0.541139393
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8C75 Distal myopathy		Click to Show/Hide the Full List
The Studied Tissue	Muscle tissue
The Specified Disease	Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000317265; Fold-change: -0.233162218; Z-score: -1.669225758
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 09 Disease of the visual system
[+] ICD-11: 9A96 Anterior uveitis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral monocyte
The Specified Disease	Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.144391125; Fold-change: 0.332024405; Z-score: 1.61663166
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 11 Disease of the circulatory system
[+] ICD-11: BA41 Myocardial infarction		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000616397; Fold-change: -0.964756513; Z-score: -1.137378913
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: BA80 Coronary artery disease		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.602352381; Fold-change: 0.375542004; Z-score: 0.638393129
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: BB70 Aortic valve stenosis		Click to Show/Hide the Full List
The Studied Tissue	Calcified aortic valve
The Specified Disease	Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.883819632; Fold-change: -0.121332984; Z-score: -0.108275038
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 12 Disease of the respiratory system
[+] ICD-11: 7A40 Central sleep apnoea		Click to Show/Hide the Full List
The Studied Tissue	Hyperplastic tonsil
The Specified Disease	Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.760905205; Fold-change: -0.010289372; Z-score: -0.016925503
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA08 Vasomotor or allergic rhinitis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.015704058; Fold-change: -0.250665703; Z-score: -1.866679842
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA0A Chronic rhinosinusitis		Click to Show/Hide the Full List
The Studied Tissue	Sinus mucosa tissue
The Specified Disease	Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.018823462; Fold-change: -0.284864564; Z-score: -0.890066118
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA22 Chronic obstructive pulmonary disease		Click to Show/Hide the Full List
The Studied Tissue	Small airway epithelium
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.003579995; Fold-change: -0.122245533; Z-score: -0.536978081
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Lung tissue
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.011687162; Fold-change: -0.034633291; Z-score: -0.162222747
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA23 Asthma		Click to Show/Hide the Full List
The Studied Tissue	Nasal and bronchial airway
The Specified Disease	Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.47E-06; Fold-change: 0.24816893; Z-score: 0.534719275
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CB03 Idiopathic interstitial pneumonitis		Click to Show/Hide the Full List
The Studied Tissue	Lung tissue
The Specified Disease	Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.384639123; Fold-change: 0.133744248; Z-score: 0.779064903
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 13 Disease of the digestive system
[+] ICD-11: DA0C Periodontal disease		Click to Show/Hide the Full List
The Studied Tissue	Gingival tissue
The Specified Disease	Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.096855685; Fold-change: -0.053066239; Z-score: -0.187022803
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: DA42 Gastritis		Click to Show/Hide the Full List
The Studied Tissue	Gastric antrum tissue
The Specified Disease	Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.175824623; Fold-change: -0.046822958; Z-score: -0.428461184
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: DB92 Non-alcoholic fatty liver disease		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.875045921; Fold-change: -0.099110833; Z-score: -0.375551899
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: DB99 Hepatic failure		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002146338; Fold-change: 0.19151507; Z-score: 1.556768868
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: DD71 Ulcerative colitis		Click to Show/Hide the Full List
The Studied Tissue	Colon mucosal tissue
The Specified Disease	Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.75987213; Fold-change: 0.105438411; Z-score: 0.322626223
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
[+] ICD-11: DD91 Irritable bowel syndrome		Click to Show/Hide the Full List
The Studied Tissue	Rectal colon tissue
The Specified Disease	Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.853043004; Fold-change: 0.022007449; Z-score: 0.187151347
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 14 Disease of the skin
[+] ICD-11: EA80 Atopic eczema		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.007475174; Fold-change: -0.093199517; Z-score: -0.718359676
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: EA90 Psoriasis		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.98E-15; Fold-change: 0.187002796; Z-score: 0.550778449
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.35E-43; Fold-change: -0.95516444; Z-score: -4.555400599
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: ED63 Acquired hypomelanotic disorder		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.985055835; Fold-change: 0.009584435; Z-score: 0.131354827
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: ED70 Alopecia or hair loss		Click to Show/Hide the Full List
The Studied Tissue	Skin from scalp
The Specified Disease	Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.257916261; Fold-change: 0.029462244; Z-score: 0.244992523
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: EK0Z Contact dermatitis		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.894879924; Fold-change: 0.034305882; Z-score: 0.507814797
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
[+] ICD-11: FA00 Osteoarthritis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.407990684; Fold-change: -0.033377655; Z-score: -0.253674489
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.424901224; Fold-change: 0.003129916; Z-score: 0.010889846
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA20 Rheumatoid arthritis		Click to Show/Hide the Full List
The Studied Tissue	Synovial tissue
The Specified Disease	Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.744873206; Fold-change: -0.141222822; Z-score: -0.48822816
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA24 Juvenile idiopathic arthritis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002150376; Fold-change: -0.043282687; Z-score: -0.241422335
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA92 Inflammatory spondyloarthritis		Click to Show/Hide the Full List
The Studied Tissue	Pheripheral blood
The Specified Disease	Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.712560243; Fold-change: 0.068310682; Z-score: 0.428830685
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FB83 Low bone mass disorder		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001080171; Fold-change: -0.451620086; Z-score: -3.940349144
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 16 Disease of the genitourinary system
[+] ICD-11: GA10 Endometriosis		Click to Show/Hide the Full List
The Studied Tissue	Endometrium tissue
The Specified Disease	Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.013599086; Fold-change: -0.262437084; Z-score: -1.117539093
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: GC00 Cystitis		Click to Show/Hide the Full List
The Studied Tissue	Bladder tissue
The Specified Disease	Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.931923498; Fold-change: -0.057744152; Z-score: -0.422524618
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 19 Certain condition originating in the perinatal period
[+] ICD-11: KA21 Short gestation disorder		Click to Show/Hide the Full List
The Studied Tissue	Myometrium
The Specified Disease	Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.262526998; Fold-change: 0.152422948; Z-score: 0.896212687
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 20 Developmental anomaly
[+] ICD-11: LD2C Overgrowth syndrome		Click to Show/Hide the Full List
The Studied Tissue	Adipose tissue
The Specified Disease	Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.562502636; Fold-change: 0.003660838; Z-score: 0.014808417
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome		Click to Show/Hide the Full List
The Studied Tissue	Perituberal tissue
The Specified Disease	Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.121516153; Fold-change: -0.115501749; Z-score: -3.753175408
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual

References
1	Differential regulation of the serotonin transporter gene by lithium is mediated by transcription factors, CCCTC binding protein and Y-box binding protein 1, through the polymorphic intron 2 variable number tandem repeat. J Neurosci. 2007 Mar 14;27(11):2793-801.
2	The Encyclopedia of DNA elements (ENCODE): data portal update. Nucleic Acids Res. 2018 Jan 4;46(D1):D794-D801
3	hTFtarget: A Comprehensive Database for Regulations of Human Transcription Factors and Their Targets. Genomics Proteomics Bioinformatics. 2020 Apr;18(2):120-469.
4	NCBI GEO: archive for functional genomics data sets--update. Nucleic Acids Res. 2013 Jan;41(D1):D991-5.
5	Closure of the NCBI SRA and implications for the long-term future of genomics data storage. Genome Biol. 2011;12(3):402.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

Transcription Factor (TF) Information

Visitor Map

Correspondence