Transcription Factor (TF) Information

General Information of This TF
TF ID	TFD0020
TF name	Cyclic AMP-responsive element-binding protein 1 (CREB1)
Synonyms	CREB-1; CREB1; cAMP-responsive element-binding protein 1
Gene Name	CREB1
Gene ID	1385
TF Classification	Superclass	Basic domains
	Class	Basic leucine zipper factors
	Family	CREB-related factors
	Subfamily	CREB-like factors
Function	This transcription factor is phosphorylation-dependent transcription factor that stimulates transcription upon binding to the DNA cAMP response element (CRE), a sequence present in many viral and cellular promoters.
Sequence	MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR VAVLENQNKTLIEELKALKDLYCHKSD
Uniprot ID	CREB1_HUMAN
Ensembl ID	ENSG00000118260
HGNC ID	HGNC:2345
JASPAR ID	MA0018.1
TF Binding Frequency Matrix

Drug Transporter(s) Regulated by This TF
Activation
ARALAR1	Transporter Info	Brain neuroblastoma [ICD11: 2A00.11]	[1]
CACNA1C	Transporter Info	Brain neuroblastoma [ICD11: 2A00.11]	[2]
CTL4	Transporter Info	Heallth [ICD11: N.A]	[3]
FLOT1	Transporter Info	Fibrosarcoma [ICD11: 2A02.10]	[4]
GLUT3	Transporter Info	Brain neuroblastoma [ICD11: 2A00.11]	[5]
OAT3	Transporter Info	Heallth [ICD11: N.A]	[6]
PEPT1	Transporter Info	Colon cancer [ICD11: 2B90]	[7]
SLC33A1	Transporter Info	Heallth [ICD11: N.A]	[8]
SLC8A2	Transporter Info	Adrenal gland pheochromocytoma [ICD11: 2D11.1]	[9]
SLC9A6	Transporter Info	Alzheimer disease [ICD11: 8A20]	[10]
SNAT1	Transporter Info	Glioma [ICD11: 2A00.0]	[11]
ZIP1	Transporter Info	Prostate cancer [ICD11: 2C82]	[12]
Direct binding
ABCA10	Transporter Info	ChIP sequencing in blood; liver	[13]
ABCA2	Transporter Info	ChIP sequencing in embryo; liver	[14]
ABCA3	Transporter Info	ChIP sequencing in liver	[15]
ABCA5	Transporter Info	ChIP sequencing in liver	[16]
ABCA7	Transporter Info	ChIP sequencing in blood; bone marrow; embryo; liver; lung; uterus	[13]
ABCB6	Transporter Info	ChIP sequencing in blood; liver	[14]
ABCB7	Transporter Info	ChIP sequencing in blood; liver	[15]
ABCB8	Transporter Info	ChIP sequencing in blood; bone marrow; embryo; liver; uterus	[16]
ABCD1	Transporter Info	ChIP sequencing in liver	[16]
ABCD3	Transporter Info	ChIP sequencing in embryo; liver	[13]
ABCD4	Transporter Info	ChIP sequencing in liver; uterus	[14]
AE2	Transporter Info	ChIP sequencing in blood; bone marrow; embryo; liver; uterus	[15]
AE4	Transporter Info	ChIP sequencing in liver	[15]
ANT3	Transporter Info	ChIP sequencing in liver; lung	[13]
ANXA2	Transporter Info	ChIP sequencing in breast; liver	[13]
ARALAR2	Transporter Info	ChIP sequencing in blood; liver; uterus	[16]
ASCT1	Transporter Info	ChIP sequencing in blood; liver	[14]
ASCT2	Transporter Info	ChIP sequencing in blood; bone marrow; liver	[15]
AST	Transporter Info	ChIP sequencing in embryo; liver; uterus	[14]
ATP2B1	Transporter Info	ChIP sequencing in blood; bone marrow; embryo; liver; lung; uterus	[14]
ATP5E	Transporter Info	ChIP sequencing in liver; lung	[15]
ATP7A	Transporter Info	ChIP sequencing in liver	[16]
ATP7B	Transporter Info	ChIP sequencing in breast; liver	[14]
CACNA1H	Transporter Info	ChIP sequencing in bone marrow; liver	[13]
CACNB2	Transporter Info	ChIP sequencing in liver	[15]
CACT	Transporter Info	ChIP sequencing in liver	[14]
CAT1	Transporter Info	ChIP sequencing in bone marrow; embryo; liver	[16]
CAT2	Transporter Info	ChIP sequencing in liver	[13]
CNT1	Transporter Info	ChIP sequencing in liver	[14]
COPT2	Transporter Info	ChIP sequencing in liver	[15]
CRTR	Transporter Info	ChIP sequencing in bone marrow; embryo; liver	[14]
CST	Transporter Info	ChIP sequencing in embryo; liver	[14]
CTL1	Transporter Info	ChIP sequencing in embryo; liver; lung	[16]
CTL2	Transporter Info	ChIP sequencing in liver	[13]
CTR1	Transporter Info	ChIP sequencing in blood; bone marrow; embryo; liver; lung; uterus	[14]
DIC	Transporter Info	ChIP sequencing in blood; liver; lung; uterus	[14]
EAAT5	Transporter Info	ChIP sequencing in liver	[16]
ENBT1	Transporter Info	ChIP sequencing in blood; liver	[15]
ENT2	Transporter Info	ChIP sequencing in bone marrow; liver	[15]
ENT3	Transporter Info	ChIP sequencing in liver	[16]
FATP1	Transporter Info	ChIP sequencing in embryo; liver	[14]
FUCT1	Transporter Info	ChIP sequencing in liver; lung	[15]
G3PP	Transporter Info	ChIP sequencing in blood; embryo; liver; uterus	[14]
G6PT	Transporter Info	ChIP sequencing in liver	[13]
GC1	Transporter Info	ChIP sequencing in liver	[16]
GDC	Transporter Info	ChIP sequencing in bone marrow; embryo; liver; lung; uterus	[15]
GLUT10	Transporter Info	ChIP sequencing in liver	[13]
GLUT12	Transporter Info	ChIP sequencing in liver	[15]
GLUT5	Transporter Info	ChIP sequencing in blood; bone marrow; liver	[13]
GLUT6	Transporter Info	ChIP sequencing in liver	[14]
GLUT8	Transporter Info	ChIP sequencing in blood; bone marrow; embryo; liver	[15]
GLYT1	Transporter Info	ChIP sequencing in liver	[15]
IREG1	Transporter Info	ChIP sequencing in liver	[13]
KCC1	Transporter Info	ChIP sequencing in blood; liver	[15]
KCC3	Transporter Info	ChIP sequencing in liver	[16]
KCC4	Transporter Info	ChIP sequencing in breast; liver	[13]
KCNJ11	Transporter Info	ChIP sequencing in liver	[13]
KCNK4	Transporter Info	ChIP sequencing in liver	[15]
KCNN1	Transporter Info	ChIP sequencing in bone marrow; embryo; liver	[14]
LAT1	Transporter Info	ChIP sequencing in embryo; liver; lung; uterus	[14]
LAT3	Transporter Info	ChIP sequencing in liver	[13]
LAT4	Transporter Info	ChIP sequencing in blood; embryo; liver; lung; uterus	[14]
MATE1	Transporter Info	ChIP sequencing in bone marrow; liver	[16]
MCPHA	Transporter Info	ChIP sequencing in blood; liver	[13]
MCT1	Transporter Info	ChIP sequencing in blood; bone marrow; embryo; liver; lung	[13]
MCT10	Transporter Info	ChIP sequencing in liver	[14]
MCT12	Transporter Info	ChIP sequencing in embryo; liver	[16]
MCT4	Transporter Info	ChIP sequencing in embryo; liver; lung; uterus	[15]
MCT6	Transporter Info	ChIP sequencing in liver	[16]
MCT7	Transporter Info	ChIP sequencing in liver	[13]
MDR3	Transporter Info	ChIP sequencing in blood; liver	[14]
MDU1	Transporter Info	ChIP sequencing in blood; bone marrow; liver	[16]
MFT	Transporter Info	ChIP sequencing in embryo; liver; lung; uterus	[13]
MRP1	Transporter Info	ChIP sequencing in liver	[15]
MRP3	Transporter Info	ChIP sequencing in liver	[13]
MRP5	Transporter Info	ChIP sequencing in bone marrow; liver; uterus	[15]
MRP7	Transporter Info	ChIP sequencing in liver	[14]
NaCT	Transporter Info	ChIP sequencing in liver	[15]
NADC3	Transporter Info	ChIP sequencing in liver	[14]
NBC3	Transporter Info	ChIP sequencing in liver	[13]
NBCe2	Transporter Info	ChIP sequencing in breast; liver	[16]
NCC	Transporter Info	ChIP sequencing in blood; liver	[14]
NDCBE	Transporter Info	ChIP sequencing in blood; bone marrow; liver	[14]
NIS	Transporter Info	ChIP sequencing in blood; liver	[13]
NPT2A	Transporter Info	ChIP sequencing in embryo; liver	[16]
NPT2C	Transporter Info	ChIP sequencing in liver	[13]
NRAMP2	Transporter Info	ChIP sequencing in liver	[13]
NTT4	Transporter Info	ChIP sequencing in embryo; liver; uterus	[16]
OATP2A1	Transporter Info	ChIP sequencing in embryo; liver	[15]
OATP4A1	Transporter Info	ChIP sequencing in liver	[16]
OCTN1	Transporter Info	ChIP sequencing in bone marrow; liver	[13]
OCTN2	Transporter Info	ChIP sequencing in liver	[16]
ODC	Transporter Info	ChIP sequencing in liver	[15]
OGC	Transporter Info	ChIP sequencing in blood; liver	[15]
ORNT3	Transporter Info	ChIP sequencing in liver; lung	[15]
OSTbeta	Transporter Info	ChIP sequencing in blood; liver	[13]
PAT1	Transporter Info	ChIP sequencing in liver; lung	[16]
PAT4	Transporter Info	ChIP sequencing in embryo; liver	[13]
PCFT	Transporter Info	ChIP sequencing in liver	[16]
PHC	Transporter Info	ChIP sequencing in bone marrow; colon; embryo; liver; lung; uterus	[16]
PIT1	Transporter Info	ChIP sequencing in embryo; liver; lung; uterus	[13]
PIT2	Transporter Info	ChIP sequencing in blood; bone marrow; embryo; liver; lung	[14]
PMP34	Transporter Info	ChIP sequencing in liver	[16]
PTR4	Transporter Info	ChIP sequencing in blood; embryo; liver	[16]
RALBP1	Transporter Info	ChIP sequencing in liver	[16]
RFVT2	Transporter Info	ChIP sequencing in blood; bone marrow; embryo; liver; lung; uterus	[14]
SAMC	Transporter Info	ChIP sequencing in embryo; liver; uterus	[16]
SAT1	Transporter Info	ChIP sequencing in liver	[14]
SCAMC1	Transporter Info	ChIP sequencing in embryo; liver	[14]
SCAMC2	Transporter Info	ChIP sequencing in blood; bone marrow; embryo; liver; lung; uterus	[15]
SCAMC3	Transporter Info	ChIP sequencing in embryo; liver	[13]
SCN4A	Transporter Info	ChIP sequencing in embryo; liver	[16]
SGLT2	Transporter Info	ChIP sequencing in liver	[15]
SLC10A7	Transporter Info	ChIP sequencing in bone marrow; embryo; liver; uterus	[15]
SLC11A1	Transporter Info	ChIP sequencing in blood; bone marrow; liver	[16]
SLC16A11	Transporter Info	ChIP sequencing in blood; liver	[15]
SLC16A13	Transporter Info	ChIP sequencing in blood; embryo; liver	[13]
SLC16A14	Transporter Info	ChIP sequencing in breast; liver	[14]
SLC17A9	Transporter Info	ChIP sequencing in embryo; liver	[16]
SLC22A17	Transporter Info	ChIP sequencing in embryo; liver	[15]
SLC22A23	Transporter Info	ChIP sequencing in liver	[16]
SLC23A3	Transporter Info	ChIP sequencing in liver	[15]
SLC24A1	Transporter Info	ChIP sequencing in liver	[16]
SLC25A1	Transporter Info	ChIP sequencing in embryo; liver	[13]
SLC25A14	Transporter Info	ChIP sequencing in embryo; liver	[13]
SLC25A15	Transporter Info	ChIP sequencing in liver	[14]
SLC25A27	Transporter Info	ChIP sequencing in liver	[13]
SLC25A28	Transporter Info	ChIP sequencing in blood; liver	[14]
SLC25A33	Transporter Info	ChIP sequencing in blood; bone marrow; embryo; liver; lung; uterus	[14]
SLC25A36	Transporter Info	ChIP sequencing in blood; bone marrow; colon; embryo; liver; lung; uterus	[15]
SLC25A37	Transporter Info	ChIP sequencing in blood; bone marrow; colon; embryo; liver; lung; uterus	[16]
SLC25A38	Transporter Info	ChIP sequencing in bone marrow; embryo; liver; uterus	[13]
SLC25A4	Transporter Info	ChIP sequencing in liver	[14]
SLC25A42	Transporter Info	ChIP sequencing in liver	[15]
SLC25A5	Transporter Info	ChIP sequencing in liver; lung; uterus	[16]
SLC26A2	Transporter Info	ChIP sequencing in liver	[15]
SLC26A6	Transporter Info	ChIP sequencing in embryo; liver	[16]
SLC26A7	Transporter Info	ChIP sequencing in liver	[13]
SLC27A2	Transporter Info	ChIP sequencing in liver	[15]
SLC27A4	Transporter Info	ChIP sequencing in embryo; liver; lung	[16]
SLC27A5	Transporter Info	ChIP sequencing in liver; lung	[13]
SLC2A11	Transporter Info	ChIP sequencing in liver	[14]
SLC2A13	Transporter Info	ChIP sequencing in liver	[16]
SLC2A9	Transporter Info	ChIP sequencing in liver	[16]
SLC35A2	Transporter Info	ChIP sequencing in blood; embryo; liver; lung; uterus	[15]
SLC35A3	Transporter Info	ChIP sequencing in liver	[16]
SLC35A4	Transporter Info	ChIP sequencing in liver; uterus	[13]
SLC35A5	Transporter Info	ChIP sequencing in blood; bone marrow; embryo; liver; lung; uterus	[14]
SLC35B1	Transporter Info	ChIP sequencing in liver; lung	[15]
SLC35B2	Transporter Info	ChIP sequencing in blood; bone marrow; embryo; liver	[16]
SLC35B3	Transporter Info	ChIP sequencing in blood; embryo; liver	[13]
SLC35B4	Transporter Info	ChIP sequencing in embryo; liver; lung; uterus	[14]
SLC35D1	Transporter Info	ChIP sequencing in embryo; liver	[16]
SLC35D2	Transporter Info	ChIP sequencing in liver	[13]
SLC35F3	Transporter Info	ChIP sequencing in blood; breast; embryo; liver	[14]
SLC35F6	Transporter Info	ChIP sequencing in bone marrow; embryo; liver; lung	[15]
SLC37A2	Transporter Info	ChIP sequencing in blood; embryo; liver	[15]
SLC37A3	Transporter Info	ChIP sequencing in liver	[16]
SLC38A10	Transporter Info	ChIP sequencing in liver; lung; uterus	[14]
SLC38A9	Transporter Info	ChIP sequencing in blood; liver	[14]
SLC41A1	Transporter Info	ChIP sequencing in liver	[14]
SLC41A2	Transporter Info	ChIP sequencing in blood; liver	[15]
SLC41A3	Transporter Info	ChIP sequencing in blood; liver	[16]
SLC45A1	Transporter Info	ChIP sequencing in blood; bone marrow; embryo; liver; lung; uterus	[14]
SLC45A4	Transporter Info	ChIP sequencing in bone marrow; embryo; liver; lung; uterus	[15]
SLC48A1	Transporter Info	ChIP sequencing in liver	[13]
SLC4A11	Transporter Info	ChIP sequencing in liver	[14]
SLC50A1	Transporter Info	ChIP sequencing in liver	[16]
SLC6A15	Transporter Info	ChIP sequencing in embryo; liver; uterus	[15]
SLC7A6	Transporter Info	ChIP sequencing in blood; bone marrow; embryo; liver; lung	[15]
SLC7A7	Transporter Info	ChIP sequencing in blood; liver	[16]
SLC8B1	Transporter Info	ChIP sequencing in bone marrow; embryo; liver	[13]
SLC9A5	Transporter Info	ChIP sequencing in blood; bone marrow; embryo; liver	[14]
SLC9A7	Transporter Info	ChIP sequencing in blood; liver	[15]
SLC9A8	Transporter Info	ChIP sequencing in blood; embryo; liver	[16]
SLC9B1	Transporter Info	ChIP sequencing in blood; bone marrow; colon; embryo; liver; lung; uterus	[13]
SLC9B2	Transporter Info	ChIP sequencing in embryo; liver	[14]
SMIT	Transporter Info	ChIP sequencing in liver	[16]
SMVT	Transporter Info	ChIP sequencing in blood; liver	[14]
SNAT2	Transporter Info	ChIP sequencing in blood; bone marrow; embryo; liver; lung; uterus	[15]
SNAT6	Transporter Info	ChIP sequencing in blood; bone marrow; colon; embryo; liver; lung; uterus	[16]
SNAT7	Transporter Info	ChIP sequencing in liver	[13]
SUR1	Transporter Info	ChIP sequencing in liver	[15]
SVCT2	Transporter Info	ChIP sequencing in blood; liver	[14]
TAPL	Transporter Info	ChIP sequencing in bone marrow; embryo; liver; uterus	[13]
TAUT	Transporter Info	ChIP sequencing in blood; liver	[13]
VACHT	Transporter Info	ChIP sequencing in liver; uterus	[13]
VGLUT1	Transporter Info	ChIP sequencing in blood; bone marrow; embryo; liver	[15]
ZIP10	Transporter Info	ChIP sequencing in blood; liver	[15]
ZIP11	Transporter Info	ChIP sequencing in blood; liver	[16]
ZIP13	Transporter Info	ChIP sequencing in bone marrow; embryo; liver; lung; uterus	[13]
ZIP14	Transporter Info	ChIP sequencing in bone marrow; breast; embryo; liver; lung	[14]
ZIP3	Transporter Info	ChIP sequencing in liver	[15]
ZIP6	Transporter Info	ChIP sequencing in liver; uterus	[16]
ZIP7	Transporter Info	ChIP sequencing in blood; embryo; liver	[13]
ZIP8	Transporter Info	ChIP sequencing in blood; bone marrow; liver	[14]
ZIP9	Transporter Info	ChIP sequencing in blood; bone marrow; liver; uterus	[15]
ZNT3	Transporter Info	ChIP sequencing in embryo; liver	[13]
ZNT5	Transporter Info	ChIP sequencing in embryo; liver; lung; uterus	[14]
ZNT6	Transporter Info	ChIP sequencing in blood; liver; lung; uterus	[15]
ZNT7	Transporter Info	ChIP sequencing in blood; liver; uterus	[16]
ZNT9	Transporter Info	ChIP sequencing in blood; bone marrow; colon; embryo; liver; lung; uterus	[13]

Disease-specific Protein Abundances of TF
ICD-11: 01 Certain infectious or parasitic disease
[+] ICD-11: 1C1H Necrotising ulcerative gingivitis		Click to Show/Hide the Full List
The Studied Tissue	Gingival tissue
The Specified Disease	Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.54E-07; Fold-change: -0.164440532; Z-score: -0.549952357
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1E30 Influenza		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.01780023; Fold-change: -0.875427207; Z-score: -3.138121783
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1E51 Chronic viral hepatitis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.380024104; Fold-change: -0.132974217; Z-score: -0.593655221
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1G41 Sepsis with septic shock		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.24E-07; Fold-change: -0.260574878; Z-score: -0.437069476
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA40 Respiratory syncytial virus infection		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00203624; Fold-change: -0.238615948; Z-score: -1.036345318
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA42 Rhinovirus infection		Click to Show/Hide the Full List
The Studied Tissue	Nasal epithelium tissue
The Specified Disease	Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.022983956; Fold-change: 0.014524828; Z-score: 0.091887108
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: KA60 Neonatal sepsis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.946320468; Fold-change: -0.077221575; Z-score: -0.132256701
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 02 Neoplasm
[+] ICD-11: 2A00 Brain cancer		Click to Show/Hide the Full List
The Studied Tissue	Nervous tissue
The Specified Disease	Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.35E-88; Fold-change: 0.746592057; Z-score: 1.578999168
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.02835071; Fold-change: 0.308534361; Z-score: 4.077664878
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	White matter tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.50E-05; Fold-change: 0.835848435; Z-score: 1.99477923
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.26E-08; Fold-change: 1.778371531; Z-score: 4.384577096
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A20 Myeloproliferative neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.004416544; Fold-change: -0.506916644; Z-score: -2.678747461
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.025452804; Fold-change: -0.086874996; Z-score: -0.457360461
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A36 Myelodysplastic syndrome		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.206199123; Fold-change: -0.082341335; Z-score: -0.114009881
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.625691989; Fold-change: 0.373731956; Z-score: 0.41433188
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A81 Diffuse large B-cell lymphoma		Click to Show/Hide the Full List
The Studied Tissue	Tonsil tissue
The Specified Disease	Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.042923048; Fold-change: -0.392936453; Z-score: -0.858201997
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A83 Plasma cell neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.053806259; Fold-change: -0.259552352; Z-score: -1.011510964
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Bone marrow
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.48435259; Fold-change: 0.07040108; Z-score: 0.223522244
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B33 Leukaemia		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.03E-09; Fold-change: -0.322310338; Z-score: -0.521156778
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B6E Oral cancer		Click to Show/Hide the Full List
The Studied Tissue	Oral tissue
The Specified Disease	Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.12E-05; Fold-change: 0.793791547; Z-score: 1.055076033
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.020365002; Fold-change: -0.197239274; Z-score: -0.353121755
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B70 Esophageal cancer		Click to Show/Hide the Full List
The Studied Tissue	Esophagus
The Specified Disease	Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.41004035; Fold-change: 0.145105664; Z-score: 0.471542583
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: 2B72 Stomach cancer		Click to Show/Hide the Full List
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.282731185; Fold-change: 0.280772672; Z-score: 0.623114411
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.021933005; Fold-change: -0.163421592; Z-score: -0.6656949
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B90 Colon cancer		Click to Show/Hide the Full List
The Studied Tissue	Colon tissue
The Specified Disease	Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.166286459; Fold-change: -0.04477872; Z-score: -0.132280928
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.010617889; Fold-change: -0.107466587; Z-score: -0.253873879
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B92 Rectal cancer		Click to Show/Hide the Full List
The Studied Tissue	Rectal colon tissue
The Specified Disease	Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.256701672; Fold-change: 0.142530248; Z-score: 0.739811476
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.145615256; Fold-change: -0.261635267; Z-score: -1.013418227
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C10 Pancreatic cancer		Click to Show/Hide the Full List
The Studied Tissue	Pancreas
The Specified Disease	Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000386335; Fold-change: 0.679985492; Z-score: 1.411140033
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.105392852; Fold-change: 0.31891727; Z-score: 0.547629181
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C12 Liver cancer		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002203747; Fold-change: 0.26383275; Z-score: 0.732534717
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.01E-06; Fold-change: 0.170565038; Z-score: 0.46347019
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.278902151; Fold-change: 0.319497069; Z-score: 0.881728622
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual Download TF expression data in the tissue of the other disease section
[+] ICD-11: 2C25 Lung cancer		Click to Show/Hide the Full List
The Studied Tissue	Lung tissue
The Specified Disease	Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.19E-27; Fold-change: -0.408526713; Z-score: -1.14465116
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.398039471; Fold-change: 0.03492861; Z-score: 0.08269995
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C30 Skin cancer		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.061706488; Fold-change: 0.583113283; Z-score: 0.683862991
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Skin
The Specified Disease	Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.59E-18; Fold-change: -0.81701604; Z-score: -1.085748451
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.58E-13; Fold-change: 0.644936311; Z-score: 0.769927674
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C6Z Breast cancer		Click to Show/Hide the Full List
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.035457932; Fold-change: 0.109084311; Z-score: 0.231749435
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.640130152; Fold-change: -0.15365654; Z-score: -0.215247965
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C73 Ovarian cancer		Click to Show/Hide the Full List
The Studied Tissue	Ovarian tissue
The Specified Disease	Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.5851654; Fold-change: -0.012419438; Z-score: -0.017962729
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.0771364; Fold-change: 0.207205883; Z-score: 0.566924953
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C77 Cervical cancer		Click to Show/Hide the Full List
The Studied Tissue	Cervical tissue
The Specified Disease	Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.47E-05; Fold-change: 0.294734591; Z-score: 0.939291424
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C78 Uterine cancer		Click to Show/Hide the Full List
The Studied Tissue	Endometrium tissue
The Specified Disease	Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.34E-06; Fold-change: 0.400033251; Z-score: 0.659024943
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.249880026; Fold-change: 0.151365822; Z-score: 0.673006613
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C82 Prostate cancer		Click to Show/Hide the Full List
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.003126831; Fold-change: -0.468849808; Z-score: -0.936446995
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C90 Renal cancer		Click to Show/Hide the Full List
The Studied Tissue	Kidney
The Specified Disease	Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.159973197; Fold-change: 0.255482624; Z-score: 0.329364686
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.33E-32; Fold-change: 0.924088137; Z-score: 2.658016073
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C92 Ureter cancer		Click to Show/Hide the Full List
The Studied Tissue	Urothelium
The Specified Disease	Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.249284672; Fold-change: -0.083372085; Z-score: -0.377265231
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C94 Bladder cancer		Click to Show/Hide the Full List
The Studied Tissue	Bladder tissue
The Specified Disease	Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.80E-13; Fold-change: -1.19350392; Z-score: -9.16226419
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D02 Retinal cancer		Click to Show/Hide the Full List
The Studied Tissue	Uvea
The Specified Disease	Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.066958407; Fold-change: -0.153770255; Z-score: -0.785942391
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D10 Thyroid cancer		Click to Show/Hide the Full List
The Studied Tissue	Thyroid
The Specified Disease	Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.19E-09; Fold-change: -0.43355874; Z-score: -0.837945962
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.005459942; Fold-change: 0.132024546; Z-score: 0.38673775
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D11 Adrenal cancer		Click to Show/Hide the Full List
The Studied Tissue	Adrenal cortex
The Specified Disease	Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.226348262; Fold-change: -0.122914843; Z-score: -0.335444586
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
[+] ICD-11: 2D12 Endocrine gland neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.142150033; Fold-change: 0.109305698; Z-score: 0.186969754
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.307459881; Fold-change: 0.183575111; Z-score: 0.503531854
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D42 Head and neck cancer		Click to Show/Hide the Full List
The Studied Tissue	Head and neck tissue
The Specified Disease	Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.19E-05; Fold-change: 0.199149921; Z-score: 0.541677364
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 03 Disease of the blood or blood-forming organs
[+] ICD-11: 3A51 Sickle cell disorder		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.677649464; Fold-change: -0.009155809; Z-score: -0.029922437
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3A70 Aplastic anaemia		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.576357006; Fold-change: -0.251568803; Z-score: -0.330444341
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3B63 Thrombocytosis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.090379224; Fold-change: -0.21025745; Z-score: -1.12798159
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3B64 Thrombocytopenia		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.489684353; Fold-change: -0.169409561; Z-score: -0.151224174
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 04 Disease of the immune system
[+] ICD-11: 4A00 Immunodeficiency		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.035235585; Fold-change: -0.190759381; Z-score: -1.099715058
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A40 Lupus erythematosus		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000718793; Fold-change: -0.259151515; Z-score: -0.617433264
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A42 Systemic sclerosis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.78E-05; Fold-change: -0.375991195; Z-score: -2.334865503
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A43 Systemic autoimmune disease		Click to Show/Hide the Full List
The Studied Tissue	Salivary gland tissue
The Specified Disease	Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.108743892; Fold-change: 0.69725444; Z-score: 2.076177837
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.67E-05; Fold-change: 1.21492543; Z-score: 5.948223443
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A62 Behcet disease		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.72486173; Fold-change: 0.072191271; Z-score: 0.250381493
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4B04 Monocyte count disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.01304163; Fold-change: -1.795005319; Z-score: -2.700960189
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 05 Endocrine, nutritional or metabolic disease
[+] ICD-11: 5A11 Type 2 diabetes mellitus		Click to Show/Hide the Full List
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.886355946; Fold-change: 0.014644136; Z-score: 0.024657815
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.631898922; Fold-change: -0.063423791; Z-score: -0.295258434
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Liver tissue
The Specified Disease	Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.101889927; Fold-change: 0.180124203; Z-score: 1.82924164
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5A80 Ovarian dysfunction		Click to Show/Hide the Full List
The Studied Tissue	Vastus lateralis muscle
The Specified Disease	Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.69598142; Fold-change: 0.069253673; Z-score: 0.233202368
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder		Click to Show/Hide the Full List
The Studied Tissue	Biceps muscle
The Specified Disease	Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.016418793; Fold-change: -0.324072499; Z-score: -2.00801811
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C56 Lysosomal disease		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.922647908; Fold-change: 0.049282283; Z-score: 0.115384928
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C80 Hyperlipoproteinaemia		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.844423429; Fold-change: 0.036711752; Z-score: 0.240207473
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.133801409; Fold-change: 0.220623959; Z-score: 0.71239545
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
[+] ICD-11: 6A02 Autism spectrum disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.031089636; Fold-change: 0.172485475; Z-score: 0.466012562
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A20 Schizophrenia		Click to Show/Hide the Full List
The Studied Tissue	Prefrontal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.724478552; Fold-change: -0.039285251; Z-score: -0.044865212
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Superior temporal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.10389654; Fold-change: 0.086833103; Z-score: 0.730762483
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A60 Bipolar disorder		Click to Show/Hide the Full List
The Studied Tissue	Prefrontal cortex
The Specified Disease	Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.794675384; Fold-change: -0.037521695; Z-score: -0.168811657
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A70 Depressive disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.791927163; Fold-change: 0.025331695; Z-score: 0.078062949
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Prefrontal cortex
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.418108216; Fold-change: -0.034231507; Z-score: -0.16608949
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 08 Disease of the nervous system
[+] ICD-11: 8A00 Parkinsonism		Click to Show/Hide the Full List
The Studied Tissue	Substantia nigra tissue
The Specified Disease	Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.424203984; Fold-change: 0.040619778; Z-score: 0.176394808
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A01 Choreiform disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.692177377; Fold-change: 0.096264783; Z-score: 0.2409244
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A20 Alzheimer disease		Click to Show/Hide the Full List
The Studied Tissue	Entorhinal cortex
The Specified Disease	Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.986382353; Fold-change: -0.015395528; Z-score: -0.087955006
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A2Y Neurocognitive impairment		Click to Show/Hide the Full List
The Studied Tissue	White matter tissue
The Specified Disease	HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.522067344; Fold-change: -0.119108786; Z-score: -0.642992709
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A40 Multiple sclerosis		Click to Show/Hide the Full List
The Studied Tissue	Plasmacytoid dendritic cells
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.200327263; Fold-change: 0.13510111; Z-score: 0.98672325
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Spinal cord
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.997908502; Fold-change: -0.088547563; Z-score: -0.253684168
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: 8A60 Epilepsy		Click to Show/Hide the Full List
The Studied Tissue	Peritumoral cortex tissue
The Specified Disease	Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.382929939; Fold-change: 0.074987662; Z-score: 2.891651875
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
The Studied Tissue	Whole blood
The Specified Disease	Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.680992903; Fold-change: 0.210982365; Z-score: 0.62597668
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B01 Subarachnoid haemorrhage		Click to Show/Hide the Full List
The Studied Tissue	Intracranial artery
The Specified Disease	Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.274873414; Fold-change: -0.146480885; Z-score: -0.408945602
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B11 Cerebral ischaemic stroke		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.07E-05; Fold-change: 0.173305521; Z-score: 1.054877218
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specified Disease	Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.278013129; Fold-change: -0.159791836; Z-score: -0.520091134
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B60 Motor neuron disease		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.02034832; Fold-change: -0.297703489; Z-score: -1.317189771
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.1584361; Fold-change: -0.148971554; Z-score: -0.535416827
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8C70 Muscular dystrophy		Click to Show/Hide the Full List
The Studied Tissue	Muscle tissue
The Specified Disease	Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.054893787; Fold-change: 0.196435418; Z-score: 0.899346734
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8C75 Distal myopathy		Click to Show/Hide the Full List
The Studied Tissue	Muscle tissue
The Specified Disease	Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000416495; Fold-change: 0.692331533; Z-score: 1.964245669
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 09 Disease of the visual system
[+] ICD-11: 9A96 Anterior uveitis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral monocyte
The Specified Disease	Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.520679665; Fold-change: 0.046270747; Z-score: 0.156246384
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 11 Disease of the circulatory system
[+] ICD-11: BA41 Myocardial infarction		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.489437574; Fold-change: -0.031170627; Z-score: -0.032859223
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: BA80 Coronary artery disease		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.398907295; Fold-change: 0.410322745; Z-score: 0.70030041
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: BB70 Aortic valve stenosis		Click to Show/Hide the Full List
The Studied Tissue	Calcified aortic valve
The Specified Disease	Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.461923159; Fold-change: -0.130421834; Z-score: -0.246985343
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 12 Disease of the respiratory system
[+] ICD-11: 7A40 Central sleep apnoea		Click to Show/Hide the Full List
The Studied Tissue	Hyperplastic tonsil
The Specified Disease	Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.843429715; Fold-change: 0.134501928; Z-score: 0.414654012
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA08 Vasomotor or allergic rhinitis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.227969281; Fold-change: -0.158961585; Z-score: -0.993504994
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA0A Chronic rhinosinusitis		Click to Show/Hide the Full List
The Studied Tissue	Sinus mucosa tissue
The Specified Disease	Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.254654456; Fold-change: 0.159246215; Z-score: 0.444873766
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA22 Chronic obstructive pulmonary disease		Click to Show/Hide the Full List
The Studied Tissue	Small airway epithelium
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000297351; Fold-change: -0.181883715; Z-score: -0.576624941
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Lung tissue
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.293188228; Fold-change: -0.115447101; Z-score: -0.318414034
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA23 Asthma		Click to Show/Hide the Full List
The Studied Tissue	Nasal and bronchial airway
The Specified Disease	Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.010606678; Fold-change: -0.509674181; Z-score: -0.750859669
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CB03 Idiopathic interstitial pneumonitis		Click to Show/Hide the Full List
The Studied Tissue	Lung tissue
The Specified Disease	Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.524601142; Fold-change: -0.152933741; Z-score: -0.70103323
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 13 Disease of the digestive system
[+] ICD-11: DA0C Periodontal disease		Click to Show/Hide the Full List
The Studied Tissue	Gingival tissue
The Specified Disease	Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.42E-06; Fold-change: -0.202978805; Z-score: -0.668800757
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: DA42 Gastritis		Click to Show/Hide the Full List
The Studied Tissue	Gastric antrum tissue
The Specified Disease	Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.751822771; Fold-change: 0.068414472; Z-score: 0.938648098
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: DB92 Non-alcoholic fatty liver disease		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.46312465; Fold-change: 0.024375682; Z-score: 0.090194493
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: DB99 Hepatic failure		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000343322; Fold-change: 0.535309134; Z-score: 1.820163437
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: DD71 Ulcerative colitis		Click to Show/Hide the Full List
The Studied Tissue	Colon mucosal tissue
The Specified Disease	Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.562779811; Fold-change: 0.118348243; Z-score: 0.23913552
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
[+] ICD-11: DD91 Irritable bowel syndrome		Click to Show/Hide the Full List
The Studied Tissue	Rectal colon tissue
The Specified Disease	Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.076896725; Fold-change: 0.050811883; Z-score: 0.167221944
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 14 Disease of the skin
[+] ICD-11: EA80 Atopic eczema		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.672797018; Fold-change: -0.008817312; Z-score: -0.02893524
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: EA90 Psoriasis		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.64E-27; Fold-change: -0.492505874; Z-score: -1.707853382
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.13E-55; Fold-change: 1.522453571; Z-score: 3.937246271
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: ED63 Acquired hypomelanotic disorder		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.6013806; Fold-change: 0.11401792; Z-score: 0.673165027
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: ED70 Alopecia or hair loss		Click to Show/Hide the Full List
The Studied Tissue	Skin from scalp
The Specified Disease	Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.013502965; Fold-change: 0.162712152; Z-score: 0.665825782
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: EK0Z Contact dermatitis		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.696916714; Fold-change: 0.243452799; Z-score: 0.787283047
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
[+] ICD-11: FA00 Osteoarthritis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.36792228; Fold-change: 0.459182223; Z-score: 0.877613094
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.681117829; Fold-change: -0.067704215; Z-score: -0.115797289
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA20 Rheumatoid arthritis		Click to Show/Hide the Full List
The Studied Tissue	Synovial tissue
The Specified Disease	Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.409377493; Fold-change: 0.08576786; Z-score: 0.284553291
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA24 Juvenile idiopathic arthritis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.59E-05; Fold-change: 0.204333877; Z-score: 0.481350907
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA92 Inflammatory spondyloarthritis		Click to Show/Hide the Full List
The Studied Tissue	Pheripheral blood
The Specified Disease	Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.683845259; Fold-change: -0.077254228; Z-score: -0.214218756
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FB83 Low bone mass disorder		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.857194525; Fold-change: -0.069726225; Z-score: -0.462504228
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 16 Disease of the genitourinary system
[+] ICD-11: GA10 Endometriosis		Click to Show/Hide the Full List
The Studied Tissue	Endometrium tissue
The Specified Disease	Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.37738097; Fold-change: -0.098767371; Z-score: -0.220112402
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: GC00 Cystitis		Click to Show/Hide the Full List
The Studied Tissue	Bladder tissue
The Specified Disease	Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.448818425; Fold-change: 0.024648048; Z-score: 0.172659427
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 19 Certain condition originating in the perinatal period
[+] ICD-11: KA21 Short gestation disorder		Click to Show/Hide the Full List
The Studied Tissue	Myometrium
The Specified Disease	Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.420567504; Fold-change: -0.284934069; Z-score: -0.817270137
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 20 Developmental anomaly
[+] ICD-11: LD2C Overgrowth syndrome		Click to Show/Hide the Full List
The Studied Tissue	Adipose tissue
The Specified Disease	Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.793869336; Fold-change: -0.168715392; Z-score: -0.238583804
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome		Click to Show/Hide the Full List
The Studied Tissue	Perituberal tissue
The Specified Disease	Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.79096522; Fold-change: 0.018971962; Z-score: 0.045644181
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual

References
1	The mitochondrial aspartate/glutamate carrier isoform 1 gene expression is regulated by CREB in neuronal cells. Int J Biochem Cell Biol. 2015 Mar;60:157-66.
2	Methamphetamine acutely inhibits voltage-gated calcium channels but chronically up-regulates L-type channels. J Neurochem. 2015 Jul;134(1):56-65.
3	Hypoxia inhibits colonic uptake of the microbiota-generated forms of vitamin B1 via HIF-1alpha-mediated transcriptional regulation of their transporters. J Biol Chem. 2022 Feb;298(2):101562.
4	The human reduced folate carrier gene is regulated by the AP2 and sp1 transcription factor families and a functional 61-base pair polymorphism. J Biol Chem. 2002 Nov 15;277(46):43873-80.
5	Akt and cAMP response element binding protein mediate 17beta-estradiol regulation of glucose transporter 3 expression in human SH-SY5Y neuroblastoma cell line. Neurosci Lett. 2015 Sep 14;604:58-63.; 2015 Sep 14;604:58-63.
6	Human organic anion transporter 3 gene is regulated constitutively and inducibly via a cAMP-response element. J Pharmacol Exp Ther. 2006 Oct;319(1):317-22.
7	Leptin transcriptionally enhances peptide transporter (hPepT1) expression and activity via the cAMP-response element-binding protein and Cdx2 transcription factors. J Biol Chem. 2007 Jan 12;282(2):1359-73.
8	The endoplasmic reticulum acetyltransferases ATase1/NAT8B and ATase2/NAT8 are differentially regulated to adjust engagement of the secretory pathway. J Neurochem. 2020 Aug;154(4):404-423.
9	Identification and characterization of the promoter and transcription factors regulating the expression of cerebral sodium/calcium exchanger 2 (NCX2) gene. Cell Calcium. 2022 Mar;102:102542.
10	Histone deacetylase-mediated regulation of endolysosomal pH. J Biol Chem. 2018 May 4;293(18):6721-6735.
11	Upregulation of the glutamine transporter through transactivation mediated by cAMP/protein kinase A signals toward exacerbation of vulnerability to oxidative stress in rat neocortical astrocytes. J Cell Physiol. 2007 Aug;212(2):375-85.
12	Transcriptional regulation of the major zinc uptake protein hZip1 in prostate cancer cells. Gene. 2009 Feb 15;431(1-2):39-46.
13	NCBI GEO: archive for functional genomics data sets--update. Nucleic Acids Res. 2013 Jan;41(D1):D991-5.
14	Closure of the NCBI SRA and implications for the long-term future of genomics data storage. Genome Biol. 2011;12(3):402.
15	The Encyclopedia of DNA elements (ENCODE): data portal update. Nucleic Acids Res. 2018 Jan 4;46(D1):D794-D801
16	hTFtarget: A Comprehensive Database for Regulations of Human Transcription Factors and Their Targets. Genomics Proteomics Bioinformatics. 2020 Apr;18(2):120-469.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

Transcription Factor (TF) Information

Visitor Map

Correspondence