Transcription Factor (TF) Information
| General Information of This TF | |||||
|---|---|---|---|---|---|
| TF ID |
TFD0045
|
||||
| TF name |
Erythroid transcription factor (GATA1)
|
||||
| Synonyms |
Eryf1; GATA-1; GATA-binding factor 1; GATA1; GF-1; GF1; NF-E1 DNA-binding protein
|
||||
| Gene Name |
GATA1
|
||||
| Gene ID | |||||
| TF Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
| Class | Other C4 zinc finger-type factors | ||||
| Family | GATA-type zinc fingers | ||||
| Subfamily | Two zinc-finger GATA factors | ||||
| Function | This transcription factor is a transcriptional activator or repressor which serves as a general switch factor for erythroid development and activates the transcription of genes involved in erythroid differentiation of K562 erythroleukemia cells, including HBB, HBG1/2, ALAS2 and HMBS. | ||||
| Sequence |
MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAAL
AYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQA VEDLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPL NSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRP LIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKD GIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGT AHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPLSS |
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| JASPAR ID | |||||
| TF Binding Frequency Matrix |
 |
||||
| Drug Transporter(s) Regulated by This TF | |||||
|---|---|---|---|---|---|
|
Activation |
|||||
|
FLOT1 |
Transporter Info |
Hepatoblastoma [ICD11: 2C12.01] |
[1] | ||
|
SLC25A27 |
Transporter Info |
Heallth [ICD11: N.A] |
[2] | ||
|
SLC26A3 |
Transporter Info |
Heallth [ICD11: N.A] |
[3] | ||
|
Direct binding |
|||||
|
ABCA1 |
Transporter Info |
ChIP sequencing in bone marrow |
[4] | ||
|
ABCA10 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
ABCA5 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
ABCA6 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
ABCA7 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
ABCA9 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver; umbilical cord blood |
[5] | ||
|
ABCB6 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
ABCB7 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
ABCB8 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[4] | ||
|
ABCD1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
ABCD3 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[4] | ||
|
AE2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
AE4 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
ANXA11 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
ANXA2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
ARALAR1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
ARALAR2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
ASCT1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
ASCT2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
AST |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
ATP2B1 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[6] | ||
|
ATP5E |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
ATP7A |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
ATP7B |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
CACNB2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
CACT |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
CAT2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
CCC9 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
CTL1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
CTL2 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver; umbilical cord blood |
[7] | ||
|
CTL4 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
CTR1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
ENBT1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
ENT2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
ENT3 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
G3PP |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
G6PT |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
GAT2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
GLUT12 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
GLUT2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
GLUT3 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
GLUT5 |
Transporter Info |
ChIP sequencing in bone marrow |
[6] | ||
|
GLUT6 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
GLUT8 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
GLYT1 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[7] | ||
|
IREG1 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver; umbilical cord blood |
[5] | ||
|
KCC1 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[5] | ||
|
KCC3 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[6] | ||
|
KCC4 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
KCNH2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
KCNJ11 |
Transporter Info |
ChIP sequencing in bone marrow |
[7] | ||
|
KCNK4 |
Transporter Info |
ChIP sequencing in blood; bone marrow; umbilical cord blood |
[6] | ||
|
KCNN1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
KCNQ1 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[4] | ||
|
LAT1 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver; umbilical cord blood |
[6] | ||
|
LAT2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
LAT3 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
LAT4 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
MCPHA |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
MCT1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
MCT6 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
MDU1 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[4] | ||
|
MFT |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
MRP1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
MRP3 |
Transporter Info |
ChIP sequencing in blood; bone marrow; umbilical cord blood |
[6] | ||
|
MRP4 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
MRP5 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver; umbilical cord blood |
[4] | ||
|
MRP6 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[5] | ||
|
MRP8 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
NADC3 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[5] | ||
|
NBAT |
Transporter Info |
ChIP sequencing in bone marrow |
[7] | ||
|
NBCe2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
NCC |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
NDCBE |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[7] | ||
|
NPT2C |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
NRAMP2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
NTT4 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
OAT6 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
OATP2B1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
OATP4C1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
OCTN1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
OCTN2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
ODC |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[5] | ||
|
OGC |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
PAT1 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[4] | ||
|
PCFT |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
PHC |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
PHT2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
PIT1 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[7] | ||
|
PIT2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
RALBP1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
SAT1 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[4] | ||
|
SCAMC2 |
Transporter Info |
ChIP sequencing in blood; bone marrow; colon; liver |
[7] | ||
|
SCAMC3 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
SCN9A |
Transporter Info |
ChIP sequencing in blood; bone marrow; umbilical cord blood |
[4] | ||
|
SERT |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
SGLT2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
SLC10A7 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
SLC11A1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
SLC18B1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
SLC22A23 |
Transporter Info |
ChIP sequencing in blood; bone marrow; colon; liver |
[6] | ||
|
SLC24A1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
SLC25A15 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
SLC25A42 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
SLC25A5 |
Transporter Info |
ChIP sequencing in bone marrow |
[7] | ||
|
SLC26A2 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[5] | ||
|
SLC27A5 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
SLC2A11 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
SLC2A13 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
SLC2A9 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
SLC33A1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
SLC35A2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
SLC35A3 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
SLC35A4 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
SLC35A5 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
SLC35B2 |
Transporter Info |
ChIP sequencing in bone marrow |
[4] | ||
|
SLC35B4 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
SLC35D1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
SLC35F6 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
SLC37A2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
SLC37A3 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
SLC38A10 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
SLC38A11 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[7] | ||
|
SLC38A8 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[6] | ||
|
SLC41A2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
SLC45A3 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[5] | ||
|
SLC45A4 |
Transporter Info |
ChIP sequencing in blood; bone marrow; umbilical cord blood |
[6] | ||
|
SLC48A1 |
Transporter Info |
ChIP sequencing in blood; bone marrow; umbilical cord blood |
[4] | ||
|
SLC50A1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
SLC6A15 |
Transporter Info |
ChIP sequencing in bone marrow |
[7] | ||
|
SLC7A11 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
SLC7A6 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[7] | ||
|
SLC7A7 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[4] | ||
|
SLC8A2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
SLC9A1 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver |
[7] | ||
|
SLC9A5 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
SLC9A7 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
SLC9B1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
SLC9B2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
SLC9C1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
SMIT |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
SMIT2 |
Transporter Info |
ChIP sequencing in bone marrow |
[6] | ||
|
SMVT |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
SNAT1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
SNAT2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
SNAT7 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
SVCT1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
SVCT2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
TAPL |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
TAUT |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
VGLUT1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
VMAT1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
ZIP1 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
ZIP10 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
ZIP11 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
ZIP13 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
ZIP14 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
ZIP2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
ZIP3 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver; umbilical cord blood |
[5] | ||
|
ZIP4 |
Transporter Info |
ChIP sequencing in blood; bone marrow; liver; umbilical cord blood |
[6] | ||
|
ZIP5 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
ZIP6 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
|
ZIP7 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
ZIP9 |
Transporter Info |
ChIP sequencing in bone marrow |
[6] | ||
|
ZNT2 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
ZNT3 |
Transporter Info |
ChIP sequencing in bone marrow |
[7] | ||
|
ZNT4 |
Transporter Info |
ChIP sequencing in bone marrow; liver |
[4] | ||
|
ZNT5 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[5] | ||
|
ZNT6 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[6] | ||
|
ZNT7 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[7] | ||
|
ZNT9 |
Transporter Info |
ChIP sequencing in blood; bone marrow |
[4] | ||
| Disease-specific Protein Abundances of TF | |||||
|---|---|---|---|---|---|
| ICD-11: 01 Certain infectious or parasitic disease | |||||
| [+] ICD-11: 1C1H Necrotising ulcerative gingivitis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Gingival tissue | ||||
| The Specified Disease | Bacterial infection of gingival [ICD-11:1C1H] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000212057; Fold-change: 0.129492392; Z-score: 0.670703772 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 1E30 Influenza | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Whole blood | ||||
| The Specified Disease | Influenza [ICD-11:1.00E+30] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.05840525; Fold-change: 0.294211169; Z-score: 1.969583876 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 1E51 Chronic viral hepatitis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Whole blood | ||||
| The Specified Disease | Chronic hepatitis C [ICD-11:1E51.1] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.037672374; Fold-change: 0.133940501; Z-score: 0.885931857 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 1G41 Sepsis with septic shock | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Whole blood | ||||
| The Specified Disease | Sepsis with septic shock [ICD-11:1G41] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.05150601; Fold-change: -0.114045896; Z-score: -0.259229273 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: CA40 Respiratory syncytial virus infection | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Peripheral blood | ||||
| The Specified Disease | Pediatric respiratory syncytial virus infection [ICD-11:CA40.11] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.002981641; Fold-change: 0.167537748; Z-score: 1.16583033 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: CA42 Rhinovirus infection | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Nasal epithelium tissue | ||||
| The Specified Disease | Rhinovirus infection [ICD-11:CA42.1] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.657387294; Fold-change: 0.01958742; Z-score: 0.164532155 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: KA60 Neonatal sepsis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Whole blood | ||||
| The Specified Disease | Neonatal sepsis [ICD-11:KA60] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.062409782; Fold-change: -0.174068017; Z-score: -0.3340976 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| ICD-11: 02 Neoplasm | |||||
| [+] ICD-11: 2A00 Brain cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Nervous tissue | ||||
| The Specified Disease | Glioblastopma [ICD-11:2A00.00] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.36E-14; Fold-change: -0.093358474; Z-score: -0.535616859 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| The Studied Tissue | Brain stem tissue | ||||
| The Specified Disease | Glioma [ICD-11:2A00.0Y-2A00.0Z] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.950365089; Fold-change: 0.020173481; Z-score: 0.133789306 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| The Studied Tissue | White matter tissue | ||||
| The Specified Disease | Glioma [ICD-11:2A00.0Y-2A00.0Z] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.15E-06; Fold-change: -0.472329408; Z-score: -3.014834991 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| The Studied Tissue | Brain stem tissue | ||||
| The Specified Disease | Neuroectodermal tumour [ICD-11:2A00.11] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.011199679; Fold-change: -0.3252938; Z-score: -0.91268879 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2A20 Myeloproliferative neoplasm | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Whole blood | ||||
| The Specified Disease | Myelofibrosis [ICD-11:2A20.2] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.047072837; Fold-change: 0.555744161; Z-score: 2.424477937 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| The Studied Tissue | Whole blood | ||||
| The Specified Disease | Polycythemia vera [ICD-11:2A20.4] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.011436575; Fold-change: 0.117914796; Z-score: 0.492415623 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2A36 Myelodysplastic syndrome | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Bone marrow | ||||
| The Specified Disease | Myelodysplastic syndrome [ICD-11:2A36-2A3Z] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.88E-05; Fold-change: 0.213004452; Z-score: 0.812861131 | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.93E-08; Fold-change: 0.668206136; Z-score: 8.030133089 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2A81 Diffuse large B-cell lymphoma | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Tonsil tissue | ||||
| The Specified Disease | Diffuse large B-cell lymphoma [ICD-11:2A81] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.931145582; Fold-change: -0.025644631; Z-score: -0.139292446 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2A83 Plasma cell neoplasm | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Peripheral blood | ||||
| The Specified Disease | Multiple myeloma [ICD-11:2A83.1] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.251735814; Fold-change: -0.121609669; Z-score: -0.910268831 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| The Studied Tissue | Bone marrow | ||||
| The Specified Disease | Multiple myeloma [ICD-11:2A83.1] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.008002004; Fold-change: -0.239740588; Z-score: -1.415667245 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2B33 Leukaemia | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Bone marrow | ||||
| The Specified Disease | Acute myelocytic leukaemia [ICD-11:2B33.1] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.04E-34; Fold-change: -1.256063131; Z-score: -2.06439413 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2B6E Oral cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Oral tissue | ||||
| The Specified Disease | Oral cancer [ICD-11:2B6E] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.69E-05; Fold-change: -0.23702474; Z-score: -1.137385922 | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.653240371; Fold-change: 0.042733622; Z-score: 0.19957703 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2B70 Esophageal cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Esophagus | ||||
| The Specified Disease | Esophagal cancer [ICD-11:2B70] | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.659425336; Fold-change: 0.078669126; Z-score: 0.345620622 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2B72 Stomach cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Gastric tissue | ||||
| The Specified Disease | Gastric cancer [ICD-11:2B72] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.248191921; Fold-change: -0.114255556; Z-score: -0.643241755 | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.230012912; Fold-change: 0.066973301; Z-score: 0.264374377 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2B90 Colon cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Colon tissue | ||||
| The Specified Disease | Colon cancer [ICD-11:2B90] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.09E-07; Fold-change: -0.075683698; Z-score: -0.36146778 | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.26E-07; Fold-change: -0.115888937; Z-score: -0.49696606 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2B92 Rectal cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Rectal colon tissue | ||||
| The Specified Disease | Rectal cancer [ICD-11:2B92] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.161386629; Fold-change: -0.103705811; Z-score: -0.343283883 | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.014468588; Fold-change: -0.184866966; Z-score: -0.988351033 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2C10 Pancreatic cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Pancreas | ||||
| The Specified Disease | Pancreatic cancer [ICD-11:2C10] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001157244; Fold-change: -0.423827859; Z-score: -1.115391167 | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 5.55E-09; Fold-change: -0.283852927; Z-score: -0.7296286 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2C12 Liver cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Liver tissue | ||||
| The Specified Disease | Liver cancer [ICD-11:2C12.0] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000864167; Fold-change: -0.113212941; Z-score: -0.61175916 | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.074249385; Fold-change: -0.042365487; Z-score: -0.1717776 | ||||
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.469052865; Fold-change: 0.071633179; Z-score: 0.287575678 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2C25 Lung cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Lung tissue | ||||
| The Specified Disease | Lung cancer [ICD-11:2C25] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.42E-09; Fold-change: -0.111396167; Z-score: -0.618383785 | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.39E-05; Fold-change: -0.0824073; Z-score: -0.340408973 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2C30 Skin cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Skin | ||||
| The Specified Disease | Melanoma [ICD-11:2C30] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.853008087; Fold-change: 0.072746056; Z-score: 0.143346669 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| The Studied Tissue | Skin | ||||
| The Specified Disease | Skin cancer [ICD-11:2C30-2C3Z] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.24E-28; Fold-change: -0.414041253; Z-score: -0.911683308 | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 3.64E-06; Fold-change: 0.281354881; Z-score: 0.712487256 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2C6Z Breast cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Breast tissue | ||||
| The Specified Disease | Breast cancer [ICD-11:2C60-2C6Z] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.004170263; Fold-change: 0.041944829; Z-score: 0.254143465 | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.239912467; Fold-change: 0.048290885; Z-score: 0.208962007 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2C73 Ovarian cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Ovarian tissue | ||||
| The Specified Disease | Ovarian cancer [ICD-11:2C73] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.186401568; Fold-change: -0.094101624; Z-score: -0.611594319 | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.002242623; Fold-change: -0.121709993; Z-score: -1.167737888 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2C77 Cervical cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Cervical tissue | ||||
| The Specified Disease | Cervical cancer [ICD-11:2C77] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.90865205; Fold-change: -0.026603665; Z-score: -0.110860595 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2C78 Uterine cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Endometrium tissue | ||||
| The Specified Disease | Uterine cancer [ICD-11:2C78] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.00050451; Fold-change: 0.114610987; Z-score: 0.477863959 | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.249145428; Fold-change: 0.164476587; Z-score: 0.836237667 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2C82 Prostate cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Prostate | ||||
| The Specified Disease | Prostate cancer [ICD-11:2C82] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.007150305; Fold-change: -0.554190708; Z-score: -1.180087001 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2C90 Renal cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Kidney | ||||
| The Specified Disease | Renal cancer [ICD-11:2C90-2C91] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000936171; Fold-change: -0.244592041; Z-score: -1.759322097 | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 8.34E-10; Fold-change: -0.22772895; Z-score: -1.100338789 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2C92 Ureter cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Urothelium | ||||
| The Specified Disease | Ureter cancer [ICD-11:2C92] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.746297474; Fold-change: 0.028300855; Z-score: 0.160852523 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2C94 Bladder cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Bladder tissue | ||||
| The Specified Disease | Bladder cancer [ICD-11:2C94] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.15547566; Fold-change: 0.074695902; Z-score: 0.519298701 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2D02 Retinal cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Uvea | ||||
| The Specified Disease | Retinoblastoma [ICD-11:2D02.2] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001171472; Fold-change: -0.401691046; Z-score: -3.713426486 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2D10 Thyroid cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Thyroid | ||||
| The Specified Disease | Thyroid cancer [ICD-11:2D10] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000626986; Fold-change: 0.102169906; Z-score: 0.474509652 | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.997777389; Fold-change: 0.010777991; Z-score: 0.061379083 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2D11 Adrenal cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Adrenal cortex | ||||
| The Specified Disease | Adrenocortical carcinoma [ICD-11:2D11.Z] | ||||
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.748041705; Fold-change: -0.042884696; Z-score: -0.144128838 | ||||
|
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2D12 Endocrine gland neoplasm | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Pituitary tissue | ||||
| The Specified Disease | Pituitary cancer [ICD-11:2D12] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.905731351; Fold-change: 0.021685745; Z-score: 0.129502284 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| The Studied Tissue | Pituitary tissue | ||||
| The Specified Disease | Pituitary gonadotrope tumour [ICD-11:2D12] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.530226932; Fold-change: -0.028642106; Z-score: -0.189642244 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 2D42 Head and neck cancer | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Head and neck tissue | ||||
| The Specified Disease | Head and neck cancer [ICD-11:2D42] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.951382798; Fold-change: -0.001461647; Z-score: -0.007952826 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| ICD-11: 03 Disease of the blood or blood-forming organs | |||||
| [+] ICD-11: 3A51 Sickle cell disorder | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Peripheral blood | ||||
| The Specified Disease | Sickle cell disease [ICD-11:3A51.0-3A51.3] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.002077338; Fold-change: 0.248610379; Z-score: 1.242934057 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 3A70 Aplastic anaemia | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Bone marrow | ||||
| The Specified Disease | Shwachman-Diamond syndrome [ICD-11:3A70.0] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.758297979; Fold-change: 0.152832732; Z-score: 0.641062423 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 3B63 Thrombocytosis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Whole blood | ||||
| The Specified Disease | Thrombocythemia [ICD-11:3B63] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.089618553; Fold-change: 0.085595576; Z-score: 0.367203473 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 3B64 Thrombocytopenia | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Whole blood | ||||
| The Specified Disease | Thrombocytopenia [ICD-11:3B64] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.315864954; Fold-change: 0.28569141; Z-score: 0.899034161 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| ICD-11: 04 Disease of the immune system | |||||
| [+] ICD-11: 4A00 Immunodeficiency | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Peripheral blood | ||||
| The Specified Disease | Immunodeficiency [ICD-11:4A00-4A20] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.49740003; Fold-change: 0.045052942; Z-score: 0.50935566 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 4A40 Lupus erythematosus | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Whole blood | ||||
| The Specified Disease | Lupus erythematosus [ICD-11:4A40] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.54E-05; Fold-change: -0.25853947; Z-score: -0.422700177 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 4A42 Systemic sclerosis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Whole blood | ||||
| The Specified Disease | Scleroderma [ICD-11:4A42.Z] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.003072982; Fold-change: -0.265409808; Z-score: -1.266874885 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 4A43 Systemic autoimmune disease | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Salivary gland tissue | ||||
| The Specified Disease | Sjogren's syndrome [ICD-11:4A43.2] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.736623288; Fold-change: -0.096370654; Z-score: -0.456845587 | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.078003667; Fold-change: -0.188218711; Z-score: -1.142232006 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 4A62 Behcet disease | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Peripheral blood | ||||
| The Specified Disease | Behcet's disease [ICD-11:4A62] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.983433433; Fold-change: 0.012063115; Z-score: 0.088774008 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 4B04 Monocyte count disorder | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Whole blood | ||||
| The Specified Disease | Autosomal dominant monocytopenia [ICD-11:4B04] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.895540005; Fold-change: 0.075963741; Z-score: 0.35163735 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| ICD-11: 05 Endocrine, nutritional or metabolic disease | |||||
| [+] ICD-11: 5A11 Type 2 diabetes mellitus | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Omental adipose tissue | ||||
| The Specified Disease | Obesity related type 2 diabetes [ICD-11:5A11] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.123808769; Fold-change: 0.191444701; Z-score: 1.431682848 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| The Studied Tissue | Omental adipose tissue | ||||
| The Specified Disease | Obesity related type 2 diabetes [ICD-11:5A11] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.120234579; Fold-change: -0.090932865; Z-score: -0.691451565 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| The Studied Tissue | Liver tissue | ||||
| The Specified Disease | Type 2 diabetes [ICD-11:5A11] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.036128521; Fold-change: -0.148496778; Z-score: -1.107507033 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 5A80 Ovarian dysfunction | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Vastus lateralis muscle | ||||
| The Specified Disease | Polycystic ovary syndrome [ICD-11:5A80.1] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.948790648; Fold-change: -0.052416901; Z-score: -0.266168131 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Biceps muscle | ||||
| The Specified Disease | Pompe disease [ICD-11:5C51.3] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.083299559; Fold-change: -0.153875809; Z-score: -0.802652095 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 5C56 Lysosomal disease | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Whole blood | ||||
| The Specified Disease | Batten disease [ICD-11:5C56.1] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.915682014; Fold-change: -0.003931918; Z-score: -0.009703303 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 5C80 Hyperlipoproteinaemia | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Peripheral blood | ||||
| The Specified Disease | Familial hypercholesterolemia [ICD-11:5C80.00] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.820569892; Fold-change: -0.044813381; Z-score: -0.191819131 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| The Studied Tissue | Whole blood | ||||
| The Specified Disease | Familial hypercholesterolemia [ICD-11:5C80.00] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 7.24E-10; Fold-change: -0.66869669; Z-score: -1.419989379 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| ICD-11: 06 Mental, behavioural or neurodevelopmental disorder | |||||
| [+] ICD-11: 6A02 Autism spectrum disorder | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Whole blood | ||||
| The Specified Disease | Autism [ICD-11:6A02] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.142230822; Fold-change: -0.18819425; Z-score: -0.649137726 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 6A20 Schizophrenia | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Prefrontal cortex | ||||
| The Specified Disease | Schizophrenia [ICD-11:6A20] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.01511011; Fold-change: 0.050994037; Z-score: 0.24668304 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| The Studied Tissue | Superior temporal cortex | ||||
| The Specified Disease | Schizophrenia [ICD-11:6A20] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.378394384; Fold-change: -0.018437774; Z-score: -0.191142155 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 6A60 Bipolar disorder | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Prefrontal cortex | ||||
| The Specified Disease | Bipolar disorder [ICD-11:6A60-6A6Z] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.641149269; Fold-change: -0.061061137; Z-score: -0.508520569 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 6A70 Depressive disorder | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Whole blood | ||||
| The Specified Disease | Major depressive disorder [ICD-11:6A70-6A7Z] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.115254539; Fold-change: 0.159981821; Z-score: 0.251463926 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| The Studied Tissue | Prefrontal cortex | ||||
| The Specified Disease | Major depressive disorder [ICD-11:6A70-6A7Z] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.4257582; Fold-change: 0.036696323; Z-score: 0.310474208 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| ICD-11: 08 Disease of the nervous system | |||||
| [+] ICD-11: 8A00 Parkinsonism | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Substantia nigra tissue | ||||
| The Specified Disease | Parkinson's disease [ICD-11:8A00.0] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.890775512; Fold-change: 0.079308893; Z-score: 0.388302558 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 8A01 Choreiform disorder | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Whole blood | ||||
| The Specified Disease | Huntington's disease [ICD-11:8A01.10] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.087150219; Fold-change: 0.163949246; Z-score: 0.62353337 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 8A20 Alzheimer disease | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Entorhinal cortex | ||||
| The Specified Disease | Alzheimer's disease [ICD-11:8A20] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.24610404; Fold-change: -0.033708268; Z-score: -0.275045654 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 8A2Y Neurocognitive impairment | Click to Show/Hide the Full List | ||||
| The Studied Tissue | White matter tissue | ||||
| The Specified Disease | HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.242804756; Fold-change: -0.08186649; Z-score: -0.450936057 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 8A40 Multiple sclerosis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Plasmacytoid dendritic cells | ||||
| The Specified Disease | Multiple sclerosis [ICD-11:8A40] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.451962969; Fold-change: -0.03983977; Z-score: -0.134995647 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| The Studied Tissue | Spinal cord | ||||
| The Specified Disease | Multiple sclerosis [ICD-11:8A40] | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.031010637; Fold-change: -0.300090207; Z-score: -3.219342887 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 8A60 Epilepsy | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Peritumoral cortex tissue | ||||
| The Specified Disease | Epilepsy [ICD-11:8A60-8A6Z] | ||||
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.187961338; Fold-change: 0.053006851; Z-score: 2.325483192 | ||||
|
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| The Studied Tissue | Whole blood | ||||
| The Specified Disease | Seizure [ICD-11:8A60-8A6Z] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.433383466; Fold-change: -0.157768163; Z-score: -0.482301622 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 8B01 Subarachnoid haemorrhage | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Intracranial artery | ||||
| The Specified Disease | Intracranial aneurysm [ICD-11:8B01.0] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.830190556; Fold-change: -0.005372662; Z-score: -0.028329957 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 8B11 Cerebral ischaemic stroke | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Whole blood | ||||
| The Specified Disease | Cardioembolic stroke [ICD-11:8B11.20] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.67E-05; Fold-change: -0.77180414; Z-score: -1.186554594 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| The Studied Tissue | Peripheral blood | ||||
| The Specified Disease | Ischemic stroke [ICD-11:8B11] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.070682097; Fold-change: 0.083536606; Z-score: 0.388658744 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 8B60 Motor neuron disease | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Skin | ||||
| The Specified Disease | Lateral sclerosis [ICD-11:8B60.4] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.498564165; Fold-change: -0.006727047; Z-score: -0.039275497 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| The Studied Tissue | Cervical spinal cord | ||||
| The Specified Disease | Lateral sclerosis [ICD-11:8B60.4] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.235940485; Fold-change: 0.041135993; Z-score: 0.187196583 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 8C70 Muscular dystrophy | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Muscle tissue | ||||
| The Specified Disease | Myopathy [ICD-11:8C70.6] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.117053969; Fold-change: -0.108007251; Z-score: -0.610239567 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: 8C75 Distal myopathy | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Muscle tissue | ||||
| The Specified Disease | Tibial muscular dystrophy [ICD-11:8C75] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000316472; Fold-change: -0.204742393; Z-score: -1.1459898 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| ICD-11: 09 Disease of the visual system | |||||
| [+] ICD-11: 9A96 Anterior uveitis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Peripheral monocyte | ||||
| The Specified Disease | Autoimmune uveitis [ICD-11:9A96] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.0530747; Fold-change: -0.130740713; Z-score: -1.730886535 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| ICD-11: 11 Disease of the circulatory system | |||||
| [+] ICD-11: BA41 Myocardial infarction | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Peripheral blood | ||||
| The Specified Disease | Myocardial infarction [ICD-11:BA41-BA50] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.118376244; Fold-change: 0.414007337; Z-score: 0.456284244 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: BA80 Coronary artery disease | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Peripheral blood | ||||
| The Specified Disease | Coronary artery disease [ICD-11:BA80-BA8Z] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.914504411; Fold-change: 0.028393228; Z-score: 0.321358853 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: BB70 Aortic valve stenosis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Calcified aortic valve | ||||
| The Specified Disease | Aortic stenosis [ICD-11:BB70] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.851794029; Fold-change: -0.0268641; Z-score: -0.041635949 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| ICD-11: 12 Disease of the respiratory system | |||||
| [+] ICD-11: 7A40 Central sleep apnoea | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Hyperplastic tonsil | ||||
| The Specified Disease | Apnea [ICD-11:7A40] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.997516303; Fold-change: -0.039807074; Z-score: -0.300450761 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: CA08 Vasomotor or allergic rhinitis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Peripheral blood | ||||
| The Specified Disease | Olive pollen allergy [ICD-11:CA08.00] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.133642585; Fold-change: 0.190132348; Z-score: 0.89938715 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: CA0A Chronic rhinosinusitis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Sinus mucosa tissue | ||||
| The Specified Disease | Chronic rhinosinusitis [ICD-11:CA0A] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.432479856; Fold-change: 0.028754955; Z-score: 0.212636643 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: CA22 Chronic obstructive pulmonary disease | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Small airway epithelium | ||||
| The Specified Disease | Chronic obstructive pulmonary disease [ICD-11:CA22] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.043877049; Fold-change: 0.120322029; Z-score: 0.527847665 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| The Studied Tissue | Lung tissue | ||||
| The Specified Disease | Chronic obstructive pulmonary disease [ICD-11:CA22] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.404022028; Fold-change: 0.028650201; Z-score: 0.154579371 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: CA23 Asthma | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Nasal and bronchial airway | ||||
| The Specified Disease | Asthma [ICD-11:CA23] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.06878417; Fold-change: -0.09009015; Z-score: -0.262218911 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: CB03 Idiopathic interstitial pneumonitis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Lung tissue | ||||
| The Specified Disease | Idiopathic pulmonary fibrosis [ICD-11:CB03.4] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.744369067; Fold-change: -0.064179453; Z-score: -0.443872677 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| ICD-11: 13 Disease of the digestive system | |||||
| [+] ICD-11: DA0C Periodontal disease | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Gingival tissue | ||||
| The Specified Disease | Periodontal disease [ICD-11:DA0C] | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 5.30E-05; Fold-change: 0.143195914; Z-score: 0.75131036 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: DA42 Gastritis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Gastric antrum tissue | ||||
| The Specified Disease | Eosinophilic gastritis [ICD-11:DA42.2] | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.125775723; Fold-change: 0.174069448; Z-score: 1.31256971 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: DB92 Non-alcoholic fatty liver disease | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Liver tissue | ||||
| The Specified Disease | Non-alcoholic fatty liver disease [ICD-11:DB92] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.023774527; Fold-change: -0.092465053; Z-score: -1.206072002 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: DB99 Hepatic failure | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Liver tissue | ||||
| The Specified Disease | Liver failure [ICD-11:DB99.7-DB99.8] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.025119478; Fold-change: 0.199210463; Z-score: 1.356239294 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: DD71 Ulcerative colitis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Colon mucosal tissue | ||||
| The Specified Disease | Ulcerative colitis [ICD-11:DD71] | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.21760843; Fold-change: 0.102664692; Z-score: 0.408087988 | ||||
|
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: DD91 Irritable bowel syndrome | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Rectal colon tissue | ||||
| The Specified Disease | Irritable bowel syndrome [ICD-11:DD91.0] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.042072944; Fold-change: -0.021124718; Z-score: -0.131021096 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| ICD-11: 14 Disease of the skin | |||||
| [+] ICD-11: EA80 Atopic eczema | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Skin | ||||
| The Specified Disease | Atopic dermatitis [ICD-11:EA80] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.006090722; Fold-change: -0.069382028; Z-score: -0.583333447 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: EA90 Psoriasis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Skin | ||||
| The Specified Disease | Psoriasis [ICD-11:EA90] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.50E-06; Fold-change: -0.126250912; Z-score: -0.299741629 | ||||
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 9.48E-29; Fold-change: 0.746165054; Z-score: 3.524352158 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: ED63 Acquired hypomelanotic disorder | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Skin | ||||
| The Specified Disease | Vitiligo [ICD-11:ED63.0] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.644661809; Fold-change: 0.008756747; Z-score: 0.082366546 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: ED70 Alopecia or hair loss | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Skin from scalp | ||||
| The Specified Disease | Alopecia [ICD-11:ED70] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.098586618; Fold-change: -0.059826476; Z-score: -0.237517618 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: EK0Z Contact dermatitis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Skin | ||||
| The Specified Disease | Sensitive skin [ICD-11:EK0Z] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.95355646; Fold-change: 0.014072785; Z-score: 0.214638325 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| ICD-11: 15 Disease of the musculoskeletal system/connective tissue | |||||
| [+] ICD-11: FA00 Osteoarthritis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Peripheral blood | ||||
| The Specified Disease | Arthropathy [ICD-11:FA00-FA5Z] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.793467572; Fold-change: 0.025097311; Z-score: 0.05141274 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| The Studied Tissue | Synovial tissue | ||||
| The Specified Disease | Osteoarthritis [ICD-11:FA00-FA0Z] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.028171633; Fold-change: -0.217810739; Z-score: -0.941551149 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: FA20 Rheumatoid arthritis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Synovial tissue | ||||
| The Specified Disease | Rheumatoid arthritis [ICD-11:FA20] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000360485; Fold-change: -0.703335308; Z-score: -3.192456176 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: FA24 Juvenile idiopathic arthritis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Peripheral blood | ||||
| The Specified Disease | Juvenile idiopathic arthritis [ICD-11:FA24] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.481659847; Fold-change: 0.047295071; Z-score: 0.050984554 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: FA92 Inflammatory spondyloarthritis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Pheripheral blood | ||||
| The Specified Disease | Ankylosing spondylitis [ICD-11:FA92.0Z] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.950826289; Fold-change: 0.019181373; Z-score: 0.152975826 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: FB83 Low bone mass disorder | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Bone marrow | ||||
| The Specified Disease | Osteoporosis [ICD-11:FB83.1] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.022633849; Fold-change: 0.168665498; Z-score: 1.748460724 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| ICD-11: 16 Disease of the genitourinary system | |||||
| [+] ICD-11: GA10 Endometriosis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Endometrium tissue | ||||
| The Specified Disease | Endometriosis [ICD-11:GA10] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.335494267; Fold-change: 0.055712938; Z-score: 0.327680514 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: GC00 Cystitis | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Bladder tissue | ||||
| The Specified Disease | Interstitial cystitis [ICD-11:GC00.3] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.04353712; Fold-change: 0.17263304; Z-score: 2.619203752 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| ICD-11: 19 Certain condition originating in the perinatal period | |||||
| [+] ICD-11: KA21 Short gestation disorder | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Myometrium | ||||
| The Specified Disease | Preterm birth [ICD-11:KA21.4Z] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.885046698; Fold-change: 0.061046328; Z-score: 0.242344129 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| ICD-11: 20 Developmental anomaly | |||||
| [+] ICD-11: LD2C Overgrowth syndrome | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Adipose tissue | ||||
| The Specified Disease | Simpson golabi behmel syndrome [ICD-11:LD2C] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.458396026; Fold-change: -0.054533254; Z-score: -1.366678385 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||
| [+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome | Click to Show/Hide the Full List | ||||
| The Studied Tissue | Perituberal tissue | ||||
| The Specified Disease | Tuberous sclerosis complex [ICD-11:LD2D.2] | ||||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.006234404; Fold-change: 0.189930751; Z-score: 2.931570293 | ||||
|
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
|
|||||
|
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
|
||||