Transcription Factor (TF) Information

General Information of This TF
TF ID	TFD0228
TF name	Friend leukemia integration 1 transcription factor (FLI1)
Synonyms	FLI1; Proto-oncogene Fli-1; Transcription factor ERGB
Gene Name	FLI1
Gene ID	2313
TF Classification	Superclass	Helix-turn-helix domains
	Class	Tryptophan cluster factors
	Family	Ets-related factors
	Subfamily	Ets-like factors
Function	This transcription factor is a sequence-specific transcriptional activator that recognises the DNA sequence 5'- C[CA]GGAAGT-3'.
Sequence	MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQ PVRVNVKREYDHMNGSRESPVDCSVSKCSKLVGGGESNPMNYNSYMDEKNGPPPPNMTTN ERRVIVPADPTLWTQEHVRQWLEWAIKEYSLMEIDTSFFQNMDGKELCKMNKEDFLRATT LYNTEVLLSHLSYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNK SPPLGGAQTISKNTEQRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCI TWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF DFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMPVTSSSFFGAAS QYWTSPTGGIYPNPNVPRHPNTHVPSHLGSYY
Uniprot ID	FLI1_HUMAN
Ensembl ID	ENSG00000151702
HGNC ID	HGNC:3749
JASPAR ID	MA0475.1
TF Binding Frequency Matrix

Drug Transporter(s) Regulated by This TF
Direct binding
ABCA1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
ABCA2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
ABCA3	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
ABCA4	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
ABCA5	Transporter Info	ChIP sequencing in blood; mesenchymal	[1]
ABCA7	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
ABCA9	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
ABCB6	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
ABCB7	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
ABCB8	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
ABCD1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
ABCD3	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
ABCD4	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[1]
ABCG1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
AE2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
AE4	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
ANT3	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[1]
ANXA11	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
ANXA2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
ARALAR1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
ARALAR2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
ASCT1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
AST	Transporter Info	ChIP sequencing in blood; mesenchymal	[3]
ATP2B1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
ATP5E	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
ATP7A	Transporter Info	ChIP sequencing in blood; mesenchymal	[2]
ATP7B	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
BCRP	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
CACNA1A	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
CACNA1C	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
CACNA1G	Transporter Info	ChIP sequencing in blood; mesenchymal	[2]
CACNB2	Transporter Info	ChIP sequencing in blood; mesenchymal	[4]
CACNB4	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
CACT	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
CAT1	Transporter Info	ChIP sequencing in blood; vein	[4]
CCC9	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
COPT2	Transporter Info	ChIP sequencing in blood; mesenchymal	[3]
CST	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
CTL1	Transporter Info	ChIP sequencing in blood; mesenchymal	[3]
CTL2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
CTL4	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
CTR1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
DIC	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[4]
EAAT1	Transporter Info	ChIP sequencing in blood	[2]
EAAT5	Transporter Info	ChIP sequencing in blood; mesenchymal	[4]
ENBT1	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[2]
ENT1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
ENT2	Transporter Info	ChIP sequencing in blood; mesenchymal	[3]
ENT3	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
FATP1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
FLOT1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
FUCT1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
G3PP	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
G6PT	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
GC1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
GDC	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
GLUT12	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
GLUT3	Transporter Info	ChIP sequencing in blood; vein	[4]
GLUT5	Transporter Info	ChIP sequencing in blood; mesenchymal	[1]
GLUT6	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
GLYT1	Transporter Info	ChIP sequencing in blood; mesenchymal	[3]
IREG1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
KCC1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
KCC2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
KCC3	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
KCC4	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
KCNK4	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
KCNMA1	Transporter Info	ChIP sequencing in blood; vein	[4]
KCNN1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
KCNQ1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
LAT1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
LAT2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
LAT3	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
LAT4	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
MCPHA	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
MCT1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
MCT2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
MCT3	Transporter Info	ChIP sequencing in blood; mesenchymal	[1]
MCT6	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
MCT7	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
MCT9	Transporter Info	ChIP sequencing in blood	[2]
MDR3	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
MDU1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
MFT	Transporter Info	ChIP sequencing in blood; mesenchymal	[2]
MRP1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
MRP3	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
MRP4	Transporter Info	ChIP sequencing in blood	[4]
MRP5	Transporter Info	ChIP sequencing in blood; mesenchymal	[1]
MRP7	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
MRP8	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
NBC3	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
NBCe2	Transporter Info	ChIP sequencing in blood; mesenchymal	[2]
NCBE	Transporter Info	ChIP sequencing in blood; mesenchymal	[3]
NCC	Transporter Info	ChIP sequencing in blood; mesenchymal	[3]
NDCBE	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
NIS	Transporter Info	ChIP sequencing in blood; mesenchymal	[4]
NKCC1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
NPT2A	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
NPT2C	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
NRAMP2	Transporter Info	ChIP sequencing in blood; mesenchymal	[1]
NTCP	Transporter Info	ChIP sequencing in blood; mesenchymal	[2]
OAT6	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
OATP2A1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
OATP2B1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
OATP3A1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
OATP4C1	Transporter Info	ChIP sequencing in blood	[2]
OATP5A1	Transporter Info	ChIP sequencing in blood; mesenchymal	[3]
OCTN1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
OCTN2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
OGC	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
ORNT3	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
OSTalpha	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
P-GP	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
PAT1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
PAT4	Transporter Info	ChIP sequencing in blood; vein	[3]
PCFT	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
PHC	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
PHT2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
PIT1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
PIT2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
PMP34	Transporter Info	ChIP sequencing in blood	[3]
PTR4	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
RALBP1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
RFVT2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
SAMC	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
SAT1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
SCAMC1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
SCAMC2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
SCAMC3	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
SCN4A	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
SCN8A	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
SCN9A	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
SGLT2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
SGLT5	Transporter Info	ChIP sequencing in mesenchymal; vein	[1]
SLC10A7	Transporter Info	ChIP sequencing in blood; mesenchymal	[3]
SLC11A1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
SLC16A11	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
SLC16A13	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
SLC17A9	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
SLC18B1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
SLC22A17	Transporter Info	ChIP sequencing in blood; mesenchymal	[3]
SLC22A23	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
SLC23A3	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
SLC24A1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
SLC25A1	Transporter Info	ChIP sequencing in blood; mesenchymal	[3]
SLC25A14	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
SLC25A15	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
SLC25A28	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
SLC25A33	Transporter Info	ChIP sequencing in blood; mesenchymal	[3]
SLC25A37	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
SLC25A38	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
SLC25A4	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
SLC25A42	Transporter Info	ChIP sequencing in blood; mesenchymal	[3]
SLC25A5	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
SLC26A4	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
SLC26A6	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
SLC27A3	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[2]
SLC27A4	Transporter Info	ChIP sequencing in blood; mesenchymal	[3]
SLC27A5	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood	[4]
SLC27A6	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
SLC2A11	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
SLC2A13	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
SLC2A9	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
SLC33A1	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[4]
SLC35A2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
SLC35A3	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
SLC35A4	Transporter Info	ChIP sequencing in blood; umbilical cord blood	[2]
SLC35A5	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[3]
SLC35B1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
SLC35B2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
SLC35B3	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
SLC35B4	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[3]
SLC35D1	Transporter Info	ChIP sequencing in blood; mesenchymal	[1]
SLC35D2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
SLC35D3	Transporter Info	ChIP sequencing in blood; mesenchymal	[3]
SLC35E4	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
SLC35F6	Transporter Info	ChIP sequencing in blood; mesenchymal	[1]
SLC37A2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
SLC37A3	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
SLC38A10	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[1]
SLC38A9	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
SLC41A1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
SLC41A2	Transporter Info	ChIP sequencing in blood	[2]
SLC41A3	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
SLC45A1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
SLC45A4	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[3]
SLC48A1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
SLC4A1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
SLC4A11	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
SLC50A1	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[2]
SLC7A11	Transporter Info	ChIP sequencing in blood	[1]
SLC7A6	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
SLC7A7	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[4]
SLC8A1	Transporter Info	ChIP sequencing in blood; vein	[2]
SLC8A2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
SLC8B1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
SLC9A1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
SLC9A3	Transporter Info	ChIP sequencing in blood; mesenchymal	[2]
SLC9A5	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
SLC9A6	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
SLC9A7	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
SLC9A8	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
SLC9B1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
SMIT	Transporter Info	ChIP sequencing in blood	[3]
SMVT	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
SNAT1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
SNAT2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
SNAT3	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
SNAT5	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
SNAT6	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
SUR1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[2]
SVCT1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
SVCT2	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
TAPL	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[3]
TAUT	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[2]
THTR1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
VGLUT1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
VMAT1	Transporter Info	ChIP sequencing in blood; mesenchymal	[2]
ZIP1	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
ZIP10	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[4]
ZIP11	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
ZIP13	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[2]
ZIP14	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[3]
ZIP3	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[4]
ZIP4	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[1]
ZIP5	Transporter Info	ChIP sequencing in blood; mesenchymal	[2]
ZIP6	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[3]
ZIP7	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[4]
ZIP8	Transporter Info	ChIP sequencing in blood; mesenchymal; vein	[1]
ZIP9	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[2]
ZNT1	Transporter Info	ChIP sequencing in blood; vein	[4]
ZNT3	Transporter Info	ChIP sequencing in blood; mesenchymal	[1]
ZNT5	Transporter Info	ChIP sequencing in blood; mesenchymal	[2]
ZNT6	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[3]
ZNT7	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[4]
ZNT9	Transporter Info	ChIP sequencing in blood; mesenchymal; umbilical cord blood; vein	[1]

Disease-specific Protein Abundances of TF
ICD-11: 01 Certain infectious or parasitic disease
[+] ICD-11: 1C1H Necrotising ulcerative gingivitis		Click to Show/Hide the Full List
The Studied Tissue	Gingival tissue
The Specified Disease	Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.60E-19; Fold-change: 0.994974398; Z-score: 1.962046234
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1E30 Influenza		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.709015817; Fold-change: 0.238937939; Z-score: 0.429493185
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1E51 Chronic viral hepatitis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.018060975; Fold-change: -0.347103596; Z-score: -1.042706777
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1G41 Sepsis with septic shock		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.187630433; Fold-change: -0.013527769; Z-score: -0.012890095
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA40 Respiratory syncytial virus infection		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.23583202; Fold-change: -0.094017942; Z-score: -0.348981317
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA42 Rhinovirus infection		Click to Show/Hide the Full List
The Studied Tissue	Nasal epithelium tissue
The Specified Disease	Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.063781115; Fold-change: 0.061792414; Z-score: 0.514401883
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: KA60 Neonatal sepsis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.03E-09; Fold-change: 1.067734162; Z-score: 1.118322443
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 02 Neoplasm
[+] ICD-11: 2A00 Brain cancer		Click to Show/Hide the Full List
The Studied Tissue	Nervous tissue
The Specified Disease	Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000167106; Fold-change: 0.077036182; Z-score: 0.204800103
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.905493071; Fold-change: -0.069457378; Z-score: -0.221218723
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	White matter tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.249332242; Fold-change: -0.230531918; Z-score: -0.366585945
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00152552; Fold-change: -0.659867862; Z-score: -1.648409027
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A20 Myeloproliferative neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.56E-14; Fold-change: -1.503795308; Z-score: -5.699868497
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.62E-32; Fold-change: -1.110223919; Z-score: -3.736547095
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A36 Myelodysplastic syndrome		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001338433; Fold-change: -0.580203825; Z-score: -0.815249138
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.078182381; Fold-change: 0.786351071; Z-score: 1.368969823
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A81 Diffuse large B-cell lymphoma		Click to Show/Hide the Full List
The Studied Tissue	Tonsil tissue
The Specified Disease	Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.56489806; Fold-change: 0.041822432; Z-score: 0.413108192
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A83 Plasma cell neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.60733221; Fold-change: 0.103515884; Z-score: 0.291909527
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Bone marrow
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.753145788; Fold-change: -0.028469496; Z-score: -0.080463545
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B33 Leukaemia		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.015815027; Fold-change: 0.141255855; Z-score: 0.205097346
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B6E Oral cancer		Click to Show/Hide the Full List
The Studied Tissue	Oral tissue
The Specified Disease	Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.875054239; Fold-change: 0.015199042; Z-score: 0.042325913
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.72E-05; Fold-change: -0.215387709; Z-score: -0.477305562
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B70 Esophageal cancer		Click to Show/Hide the Full List
The Studied Tissue	Esophagus
The Specified Disease	Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.016142024; Fold-change: -0.834460441; Z-score: -1.876200978
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: 2B72 Stomach cancer		Click to Show/Hide the Full List
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.977060806; Fold-change: 0.028119601; Z-score: 0.103082859
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.99E-06; Fold-change: 0.367098385; Z-score: 1.369618006
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B90 Colon cancer		Click to Show/Hide the Full List
The Studied Tissue	Colon tissue
The Specified Disease	Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.46E-27; Fold-change: -0.719240215; Z-score: -1.342070483
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.001274529; Fold-change: -0.113071076; Z-score: -0.172926851
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B92 Rectal cancer		Click to Show/Hide the Full List
The Studied Tissue	Rectal colon tissue
The Specified Disease	Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.04559158; Fold-change: -0.340925253; Z-score: -1.528690801
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.002340462; Fold-change: -0.651833065; Z-score: -2.318688496
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C10 Pancreatic cancer		Click to Show/Hide the Full List
The Studied Tissue	Pancreas
The Specified Disease	Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.897559975; Fold-change: 0.057424598; Z-score: 0.082612069
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.012149958; Fold-change: -0.017822769; Z-score: -0.018597958
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C12 Liver cancer		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.202526389; Fold-change: -0.110246828; Z-score: -0.199453303
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.589750371; Fold-change: 0.072812604; Z-score: 0.127948925
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.365742043; Fold-change: -0.500774687; Z-score: -0.662671311
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual Download TF expression data in the tissue of the other disease section
[+] ICD-11: 2C25 Lung cancer		Click to Show/Hide the Full List
The Studied Tissue	Lung tissue
The Specified Disease	Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.83E-39; Fold-change: -1.578980546; Z-score: -1.505884969
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.54E-26; Fold-change: -1.855463767; Z-score: -1.414241
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C30 Skin cancer		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.071872951; Fold-change: 0.608270885; Z-score: 0.828875052
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Skin
The Specified Disease	Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.57E-27; Fold-change: -1.161418753; Z-score: -1.358118058
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.003964792; Fold-change: 0.182738379; Z-score: 0.294061357
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C6Z Breast cancer		Click to Show/Hide the Full List
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.52E-06; Fold-change: -0.296450119; Z-score: -0.35916462
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.006700504; Fold-change: -0.252237528; Z-score: -0.269927839
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C73 Ovarian cancer		Click to Show/Hide the Full List
The Studied Tissue	Ovarian tissue
The Specified Disease	Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.947210583; Fold-change: 0.023528863; Z-score: 0.056351747
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.025656006; Fold-change: -0.272928513; Z-score: -0.195467025
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C77 Cervical cancer		Click to Show/Hide the Full List
The Studied Tissue	Cervical tissue
The Specified Disease	Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00026339; Fold-change: 0.310926554; Z-score: 1.274333835
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C78 Uterine cancer		Click to Show/Hide the Full List
The Studied Tissue	Endometrium tissue
The Specified Disease	Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.039349296; Fold-change: -0.013638753; Z-score: -0.037219245
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.125648582; Fold-change: 0.008042697; Z-score: 0.037785307
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C82 Prostate cancer		Click to Show/Hide the Full List
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.007183666; Fold-change: -0.272441828; Z-score: -0.387359373
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C90 Renal cancer		Click to Show/Hide the Full List
The Studied Tissue	Kidney
The Specified Disease	Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.038626953; Fold-change: 0.477258995; Z-score: 0.726107143
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.16E-09; Fold-change: 0.492785628; Z-score: 1.092590422
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C92 Ureter cancer		Click to Show/Hide the Full List
The Studied Tissue	Urothelium
The Specified Disease	Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.078585234; Fold-change: -0.091272765; Z-score: -0.443543413
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C94 Bladder cancer		Click to Show/Hide the Full List
The Studied Tissue	Bladder tissue
The Specified Disease	Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.121921253; Fold-change: -0.085596884; Z-score: -0.178747732
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D02 Retinal cancer		Click to Show/Hide the Full List
The Studied Tissue	Uvea
The Specified Disease	Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000167096; Fold-change: 0.745015655; Z-score: 9.035584755
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D10 Thyroid cancer		Click to Show/Hide the Full List
The Studied Tissue	Thyroid
The Specified Disease	Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.58863487; Fold-change: 0.104550242; Z-score: 0.138480589
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.278549021; Fold-change: -0.264085196; Z-score: -0.37649965
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D11 Adrenal cancer		Click to Show/Hide the Full List
The Studied Tissue	Adrenal cortex
The Specified Disease	Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.371183392; Fold-change: -0.117136037; Z-score: -0.871700736
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
[+] ICD-11: 2D12 Endocrine gland neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.300785999; Fold-change: 0.046534043; Z-score: 0.282539501
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.979929237; Fold-change: 0.006411697; Z-score: 0.031910994
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D42 Head and neck cancer		Click to Show/Hide the Full List
The Studied Tissue	Head and neck tissue
The Specified Disease	Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.94E-06; Fold-change: 0.483270095; Z-score: 0.591113989
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 03 Disease of the blood or blood-forming organs
[+] ICD-11: 3A51 Sickle cell disorder		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.214105987; Fold-change: 0.080725037; Z-score: 0.447169271
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3A70 Aplastic anaemia		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.634734687; Fold-change: -0.42467307; Z-score: -0.530226185
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3B63 Thrombocytosis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.25E-22; Fold-change: -1.28939895; Z-score: -5.007800035
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3B64 Thrombocytopenia		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.480588783; Fold-change: 0.0172943; Z-score: 0.033410289
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 04 Disease of the immune system
[+] ICD-11: 4A00 Immunodeficiency		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.01883002; Fold-change: -0.733014429; Z-score: -1.526989697
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A40 Lupus erythematosus		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.007079271; Fold-change: 0.244058096; Z-score: 0.346378961
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A42 Systemic sclerosis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.496740179; Fold-change: -0.051372127; Z-score: -0.354317555
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A43 Systemic autoimmune disease		Click to Show/Hide the Full List
The Studied Tissue	Salivary gland tissue
The Specified Disease	Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.724134387; Fold-change: 0.006136774; Z-score: 0.022108655
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.297949031; Fold-change: 0.189786651; Z-score: 1.067025522
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A62 Behcet disease		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.807102834; Fold-change: -0.01069271; Z-score: -0.027515907
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4B04 Monocyte count disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.027778177; Fold-change: -2.442761921; Z-score: -2.224308571
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 05 Endocrine, nutritional or metabolic disease
[+] ICD-11: 5A11 Type 2 diabetes mellitus		Click to Show/Hide the Full List
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.539080637; Fold-change: -0.036772328; Z-score: -0.151816318
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.191490298; Fold-change: 0.135745294; Z-score: 0.521054841
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Liver tissue
The Specified Disease	Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.58130675; Fold-change: 0.067601446; Z-score: 0.479147902
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5A80 Ovarian dysfunction		Click to Show/Hide the Full List
The Studied Tissue	Vastus lateralis muscle
The Specified Disease	Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.897359282; Fold-change: -0.006636443; Z-score: -0.032591904
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder		Click to Show/Hide the Full List
The Studied Tissue	Biceps muscle
The Specified Disease	Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.803507622; Fold-change: 0.082292246; Z-score: 0.485303997
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C56 Lysosomal disease		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.32788904; Fold-change: -0.126270147; Z-score: -0.417735128
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C80 Hyperlipoproteinaemia		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000454506; Fold-change: -0.378321563; Z-score: -1.501906018
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.070162181; Fold-change: 0.364765625; Z-score: 0.544243563
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
[+] ICD-11: 6A02 Autism spectrum disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.729393325; Fold-change: 0.230457468; Z-score: 0.222671344
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A20 Schizophrenia		Click to Show/Hide the Full List
The Studied Tissue	Prefrontal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.121031361; Fold-change: 0.022306685; Z-score: 0.013116337
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Superior temporal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.431483782; Fold-change: 0.048309295; Z-score: 0.375345561
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A60 Bipolar disorder		Click to Show/Hide the Full List
The Studied Tissue	Prefrontal cortex
The Specified Disease	Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002101983; Fold-change: -0.163689831; Z-score: -1.019710372
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A70 Depressive disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.498290152; Fold-change: 0.062865761; Z-score: 0.12738778
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Prefrontal cortex
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.191208395; Fold-change: -0.110467238; Z-score: -0.689424695
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 08 Disease of the nervous system
[+] ICD-11: 8A00 Parkinsonism		Click to Show/Hide the Full List
The Studied Tissue	Substantia nigra tissue
The Specified Disease	Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.872389444; Fold-change: 0.060933666; Z-score: 0.134939298
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A01 Choreiform disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.527299238; Fold-change: 0.081976419; Z-score: 0.110069764
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A20 Alzheimer disease		Click to Show/Hide the Full List
The Studied Tissue	Entorhinal cortex
The Specified Disease	Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.73E-07; Fold-change: 0.249867772; Z-score: 0.920437799
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A2Y Neurocognitive impairment		Click to Show/Hide the Full List
The Studied Tissue	White matter tissue
The Specified Disease	HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.280172551; Fold-change: 0.059667533; Z-score: 0.220188013
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A40 Multiple sclerosis		Click to Show/Hide the Full List
The Studied Tissue	Plasmacytoid dendritic cells
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.173444242; Fold-change: 0.29718806; Z-score: 0.709695859
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Spinal cord
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.930393829; Fold-change: -0.024449739; Z-score: -0.076622595
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: 8A60 Epilepsy		Click to Show/Hide the Full List
The Studied Tissue	Peritumoral cortex tissue
The Specified Disease	Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.482837942; Fold-change: -0.62245752; Z-score: -0.925245847
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
The Studied Tissue	Whole blood
The Specified Disease	Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.356561866; Fold-change: -0.193883726; Z-score: -0.383470629
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B01 Subarachnoid haemorrhage		Click to Show/Hide the Full List
The Studied Tissue	Intracranial artery
The Specified Disease	Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.297533986; Fold-change: 0.56642694; Z-score: 0.796528437
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B11 Cerebral ischaemic stroke		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.104878719; Fold-change: 0.260945893; Z-score: 1.165273352
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specified Disease	Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.146308685; Fold-change: -0.365031495; Z-score: -0.781644193
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B60 Motor neuron disease		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.639231939; Fold-change: -0.201077678; Z-score: -0.398249363
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.146780248; Fold-change: -0.076488771; Z-score: -0.23571052
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8C70 Muscular dystrophy		Click to Show/Hide the Full List
The Studied Tissue	Muscle tissue
The Specified Disease	Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.006131285; Fold-change: 0.616496376; Z-score: 0.934480858
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8C75 Distal myopathy		Click to Show/Hide the Full List
The Studied Tissue	Muscle tissue
The Specified Disease	Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.52E-06; Fold-change: 0.976226137; Z-score: 2.753544468
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 09 Disease of the visual system
[+] ICD-11: 9A96 Anterior uveitis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral monocyte
The Specified Disease	Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.230820776; Fold-change: -0.854295776; Z-score: -0.897850014
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 11 Disease of the circulatory system
[+] ICD-11: BA41 Myocardial infarction		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.004854151; Fold-change: -0.333230003; Z-score: -0.604039576
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: BA80 Coronary artery disease		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.313254742; Fold-change: 0.033568505; Z-score: 0.276721786
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: BB70 Aortic valve stenosis		Click to Show/Hide the Full List
The Studied Tissue	Calcified aortic valve
The Specified Disease	Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.455047382; Fold-change: 0.267117489; Z-score: 0.393631796
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 12 Disease of the respiratory system
[+] ICD-11: 7A40 Central sleep apnoea		Click to Show/Hide the Full List
The Studied Tissue	Hyperplastic tonsil
The Specified Disease	Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.016820779; Fold-change: 0.315611786; Z-score: 1.273882146
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA08 Vasomotor or allergic rhinitis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.129007953; Fold-change: 0.275047906; Z-score: 1.085911803
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA0A Chronic rhinosinusitis		Click to Show/Hide the Full List
The Studied Tissue	Sinus mucosa tissue
The Specified Disease	Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.66108664; Fold-change: -0.017614319; Z-score: -0.037636526
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA22 Chronic obstructive pulmonary disease		Click to Show/Hide the Full List
The Studied Tissue	Small airway epithelium
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.839238059; Fold-change: 0.022082412; Z-score: 0.073451626
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Lung tissue
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.66501391; Fold-change: -0.105937476; Z-score: -0.151535695
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA23 Asthma		Click to Show/Hide the Full List
The Studied Tissue	Nasal and bronchial airway
The Specified Disease	Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.870322944; Fold-change: -0.029122068; Z-score: -0.104966484
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CB03 Idiopathic interstitial pneumonitis		Click to Show/Hide the Full List
The Studied Tissue	Lung tissue
The Specified Disease	Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.003181092; Fold-change: -0.532980033; Z-score: -2.985240634
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 13 Disease of the digestive system
[+] ICD-11: DA0C Periodontal disease		Click to Show/Hide the Full List
The Studied Tissue	Gingival tissue
The Specified Disease	Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.51E-14; Fold-change: 0.791440717; Z-score: 1.570244965
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: DA42 Gastritis		Click to Show/Hide the Full List
The Studied Tissue	Gastric antrum tissue
The Specified Disease	Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.544316956; Fold-change: 0.02315599; Z-score: 0.039083141
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: DB92 Non-alcoholic fatty liver disease		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.377530534; Fold-change: -0.037144257; Z-score: -0.15860834
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: DB99 Hepatic failure		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.128912604; Fold-change: 0.125742839; Z-score: 0.622476711
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: DD71 Ulcerative colitis		Click to Show/Hide the Full List
The Studied Tissue	Colon mucosal tissue
The Specified Disease	Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.008209963; Fold-change: 0.158735742; Z-score: 0.762184389
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
[+] ICD-11: DD91 Irritable bowel syndrome		Click to Show/Hide the Full List
The Studied Tissue	Rectal colon tissue
The Specified Disease	Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.911451827; Fold-change: -0.051700352; Z-score: -0.147495882
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 14 Disease of the skin
[+] ICD-11: EA80 Atopic eczema		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.006214858; Fold-change: -0.36757466; Z-score: -0.737050148
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: EA90 Psoriasis		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.28E-11; Fold-change: -1.11232302; Z-score: -1.419740792
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.44E-29; Fold-change: 0.772073989; Z-score: 2.0852342
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: ED63 Acquired hypomelanotic disorder		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.690357238; Fold-change: 0.062805353; Z-score: 0.171739725
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: ED70 Alopecia or hair loss		Click to Show/Hide the Full List
The Studied Tissue	Skin from scalp
The Specified Disease	Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.109913594; Fold-change: 0.117721387; Z-score: 0.572486847
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: EK0Z Contact dermatitis		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.892370696; Fold-change: 0.080643754; Z-score: 0.188597307
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
[+] ICD-11: FA00 Osteoarthritis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.65596374; Fold-change: 0.097720614; Z-score: 0.243811289
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.716965183; Fold-change: -0.040741858; Z-score: -0.332403558
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA20 Rheumatoid arthritis		Click to Show/Hide the Full List
The Studied Tissue	Synovial tissue
The Specified Disease	Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.42E-07; Fold-change: 1.562905293; Z-score: 5.468443789
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA24 Juvenile idiopathic arthritis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.119564114; Fold-change: -0.112203339; Z-score: -0.181831127
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA92 Inflammatory spondyloarthritis		Click to Show/Hide the Full List
The Studied Tissue	Pheripheral blood
The Specified Disease	Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.720004362; Fold-change: 0.102190597; Z-score: 0.268475607
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FB83 Low bone mass disorder		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.312112763; Fold-change: 0.28822351; Z-score: 0.73914629
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 16 Disease of the genitourinary system
[+] ICD-11: GA10 Endometriosis		Click to Show/Hide the Full List
The Studied Tissue	Endometrium tissue
The Specified Disease	Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.123000737; Fold-change: -0.004260553; Z-score: -0.015656369
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: GC00 Cystitis		Click to Show/Hide the Full List
The Studied Tissue	Bladder tissue
The Specified Disease	Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002041336; Fold-change: 1.324753255; Z-score: 2.878015565
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 19 Certain condition originating in the perinatal period
[+] ICD-11: KA21 Short gestation disorder		Click to Show/Hide the Full List
The Studied Tissue	Myometrium
The Specified Disease	Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.640228396; Fold-change: -0.295923524; Z-score: -0.394036849
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 20 Developmental anomaly
[+] ICD-11: LD2C Overgrowth syndrome		Click to Show/Hide the Full List
The Studied Tissue	Adipose tissue
The Specified Disease	Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.15748373; Fold-change: 0.146750252; Z-score: 1.885685984
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome		Click to Show/Hide the Full List
The Studied Tissue	Perituberal tissue
The Specified Disease	Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.3868446; Fold-change: -0.026432553; Z-score: -0.170202003
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual

References
1	hTFtarget: A Comprehensive Database for Regulations of Human Transcription Factors and Their Targets. Genomics Proteomics Bioinformatics. 2020 Apr;18(2):120-469.
2	NCBI GEO: archive for functional genomics data sets--update. Nucleic Acids Res. 2013 Jan;41(D1):D991-5.
3	Closure of the NCBI SRA and implications for the long-term future of genomics data storage. Genome Biol. 2011;12(3):402.
4	The Encyclopedia of DNA elements (ENCODE): data portal update. Nucleic Acids Res. 2018 Jan 4;46(D1):D794-D801

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

Transcription Factor (TF) Information

Visitor Map

Correspondence