Transcription Factor (TF) Information

General Information of This TF
TF ID	TFD0084
TF name	Myc-associated zinc finger protein (MAZ)
Synonyms	MAZ; MAZI; Pur-1; Purine-binding transcription factor; SAF-1; Serum amyloid A-activating factor-1; Transcription factor Zif87; ZF87; ZNF801; Zinc finger protein 801
Gene Name	MAZ
Gene ID	4150
TF Classification	Superclass	Zinc-coordinating DNA-binding domains
	Class	C2H2 zinc finger factors
	Family	Factors with multiple dispersed zinc fingers
	Subfamily	MAZ-like factors
Function	This transcription factor is a transcriptional regulator, potentially with dual roles in transcription initiation and termination. Isoform 1 binds DNA and functions as a transcriptional activator. Isoform 2 binds DNA and functions as a transcriptional activator. Inhibits MAZ isoform 1-mediated transcription. Isoform 3 binds DNA and functions as a transcriptional activator.
Sequence	MFPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSRFFASQGCAQ SPFQAAPAPPPTPQAPAAEPLQVDLLPVLAAAQESAAAAAAAAAAAAAVAAAPPAPAAAS TVDTAALKQPPAPPPPPPPVSAPAAEAAPPASAATIAAAAATAVVAPTSTVAVAPVASAL EKKTKSKGPYICALCAKEFKNGYNLRRHEAIHTGAKAGRVPSGAMKMPTMVPLSLLSVPQ LSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHACEMCGKAFRDVYHLNRHKLS HSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVH STERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHV CELCNKGTGEVCPMAAAAAAAAAAAAAAVAAPPTAVGSLSGAEGVPVSSQPLPSQPW
Uniprot ID	MAZ_HUMAN
Ensembl ID	ENSG00000103495
HGNC ID	HGNC:6914
JASPAR ID	MA1522.1
TF Binding Frequency Matrix

Drug Transporter(s) Regulated by This TF
Activation
ENT1	Transporter Info	Glioblastoma [ICD11: 2A00.00]	[1]
Direct binding
ABCA1	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[2]
ABCA2	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
ABCA3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
ABCA4	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[5]
ABCA5	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
ABCA7	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
ABCB6	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
ABCB8	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
ABCD1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
ABCD3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
ABCD4	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[4]
ABCG1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[5]
AE2	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
AE3	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[5]
AE4	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[2]
ANT3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
ANXA11	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
ANXA2	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[2]
ARALAR1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
ARALAR2	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
ASC1	Transporter Info	ChIP sequencing in bone marrow; lung	[3]
ASCT1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
ASCT2	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
AST	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
ATP10A	Transporter Info	ChIP sequencing in lung	[4]
ATP12A	Transporter Info	ChIP sequencing in blood; lung	[4]
ATP2B1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
ATP5E	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
ATP7A	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
ATP7B	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
BCRP	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[5]
BGT1	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[2]
CACNA1A	Transporter Info	ChIP sequencing in bone marrow; cervix; liver; lung	[3]
CACNA1C	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[5]
CACNA1G	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[5]
CACNB2	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[2]
CACNG2	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[4]
CACT	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
CAT1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
CAT2	Transporter Info	ChIP sequencing in blood; cervix; liver; lung	[5]
CCC9	Transporter Info	ChIP sequencing in lung	[2]
CNT1	Transporter Info	ChIP sequencing in lung	[5]
COPT2	Transporter Info	ChIP sequencing in bone marrow; cervix; lung	[2]
CRTR	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
CST	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
CTL1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
CTL2	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[3]
CTL4	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
CTR1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
DIC	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
EAAT1	Transporter Info	ChIP sequencing in blood; lung	[5]
EAAT5	Transporter Info	ChIP sequencing in bone marrow; liver; lung	[4]
ENBT1	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[5]
ENT2	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
ENT3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
ENT4	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[4]
FATP1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
FLOT1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
FUCT1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
G3PP	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[3]
G6PT	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
GAT2	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[3]
GC1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
GC2	Transporter Info	ChIP sequencing in lung	[3]
GDC	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
GLUT1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
GLUT10	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[2]
GLUT12	Transporter Info	ChIP sequencing in lung	[4]
GLUT2	Transporter Info	ChIP sequencing in lung	[2]
GLUT3	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[3]
GLUT4	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
GLUT5	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[5]
GLUT6	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[2]
GLUT8	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
GLYT1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
IREG1	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[3]
KCC1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
KCC3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
KCC4	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
KCNH2	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[3]
KCNJ11	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
KCNK4	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
KCNMA1	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[5]
KCNN1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
KCNQ1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[2]
LAT1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
LAT2	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[5]
LAT3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
LAT4	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
MATE1	Transporter Info	ChIP sequencing in blood; liver; lung	[3]
MCPHA	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[4]
MCT1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
MCT10	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[3]
MCT12	Transporter Info	ChIP sequencing in blood; lung	[5]
MCT2	Transporter Info	ChIP sequencing in blood; cervix; liver; lung	[3]
MCT3	Transporter Info	ChIP sequencing in lung	[4]
MCT4	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
MCT6	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
MCT7	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
MCT9	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[5]
MDU1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
MFT	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
MRP1	Transporter Info	ChIP sequencing in bone marrow; lung	[4]
MRP3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
MRP4	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[2]
MRP5	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
MRP7	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
MRP8	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
NaCT	Transporter Info	ChIP sequencing in liver; lung	[5]
NADC3	Transporter Info	ChIP sequencing in bone marrow; liver; lung	[3]
NBC3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
NBCe1	Transporter Info	ChIP sequencing in blood; lung	[2]
NBCe2	Transporter Info	ChIP sequencing in bone marrow; lung	[3]
NCC	Transporter Info	ChIP sequencing in blood; cervix; lung	[2]
NDCBE	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[5]
NIS	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[4]
NKCC1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[5]
NPT2A	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
NPT2C	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
NRAMP2	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
NTT4	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[5]
OAT2	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[2]
OAT6	Transporter Info	ChIP sequencing in bone marrow; lung	[4]
OATP2A1	Transporter Info	ChIP sequencing in blood; lung	[2]
OATP2B1	Transporter Info	ChIP sequencing in bone marrow; cervix; liver; lung	[5]
OATP3A1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
OATP4A1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
OATP4C1	Transporter Info	ChIP sequencing in blood; liver; lung	[5]
OATP5A1	Transporter Info	ChIP sequencing in blood; lung	[2]
OCT-3	Transporter Info	ChIP sequencing in liver	[4]
OCTN1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
OCTN2	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
ODC	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[2]
OGC	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
ORNT3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
OSTalpha	Transporter Info	ChIP sequencing in bone marrow; lung	[4]
OSTbeta	Transporter Info	ChIP sequencing in lung	[5]
PAT1	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[5]
PAT4	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
PCFT	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
PHC	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[3]
PHT2	Transporter Info	ChIP sequencing in lung	[4]
PIT1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
PIT2	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
PMP34	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
PROT	Transporter Info	ChIP sequencing in bone marrow; lung	[3]
PTR4	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
RALBP1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
RFVT1	Transporter Info	ChIP sequencing in lung	[2]
RFVT2	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
SAMC	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
SAT1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
SCAMC1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[5]
SCAMC2	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
SCAMC3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
SCN4A	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[5]
SCN8A	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[2]
SCN9A	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[3]
SGLT2	Transporter Info	ChIP sequencing in bone marrow; liver; lung	[2]
SGLT5	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
SLC10A7	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
SLC11A1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
SLC16A11	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[4]
SLC16A13	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
SLC16A2	Transporter Info	ChIP sequencing in blood; lung	[3]
SLC17A9	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[4]
SLC18B1	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[2]
SLC22A17	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[3]
SLC22A23	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
SLC23A3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
SLC24A1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
SLC25A1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
SLC25A14	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[3]
SLC25A15	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
SLC25A27	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
SLC25A28	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
SLC25A33	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
SLC25A36	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
SLC25A37	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
SLC25A38	Transporter Info	ChIP sequencing in bone marrow; cervix; liver; lung	[4]
SLC25A4	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
SLC25A42	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
SLC26A2	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[5]
SLC26A4	Transporter Info	ChIP sequencing in blood; lung	[2]
SLC26A6	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
SLC27A3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[5]
SLC27A4	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
SLC27A5	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
SLC27A6	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[4]
SLC2A11	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
SLC2A13	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
SLC2A9	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[4]
SLC33A1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
SLC35A2	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[4]
SLC35A3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
SLC35A4	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[2]
SLC35A5	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
SLC35B1	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[4]
SLC35B2	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
SLC35B3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
SLC35B4	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
SLC35D1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
SLC35D2	Transporter Info	ChIP sequencing in bone marrow; cervix; lung	[2]
SLC35E4	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[3]
SLC35F6	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
SLC37A2	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[4]
SLC37A3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
SLC38A10	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
SLC38A8	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[3]
SLC38A9	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[4]
SLC41A1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
SLC41A2	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
SLC41A3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
SLC45A1	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[5]
SLC45A3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
SLC45A4	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[3]
SLC48A1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
SLC4A1	Transporter Info	ChIP sequencing in bone marrow; lung	[2]
SLC4A11	Transporter Info	ChIP sequencing in blood; cervix; lung	[3]
SLC50A1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
SLC6A15	Transporter Info	ChIP sequencing in blood; lung	[4]
SLC7A11	Transporter Info	ChIP sequencing in bone marrow; lung	[4]
SLC7A6	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
SLC7A7	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[4]
SLC8A1	Transporter Info	ChIP sequencing in lung	[2]
SLC8A2	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
SLC8A3	Transporter Info	ChIP sequencing in blood; lung	[4]
SLC8B1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
SLC9A1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
SLC9A3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[3]
SLC9A5	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[4]
SLC9A6	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
SLC9A7	Transporter Info	ChIP sequencing in blood; cervix; lung	[2]
SLC9A8	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
SLC9B1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
SLC9B2	Transporter Info	ChIP sequencing in bone marrow; lung	[5]
SMIT	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
SMIT2	Transporter Info	ChIP sequencing in bone marrow; liver; lung	[5]
SMVT	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
SNAT1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
SNAT2	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
SNAT3	Transporter Info	ChIP sequencing in blood; liver; lung	[2]
SNAT4	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[3]
SNAT5	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
SNAT6	Transporter Info	ChIP sequencing in bone marrow; cervix; lung	[5]
SNAT7	Transporter Info	ChIP sequencing in bone marrow; lung	[2]
SUR1	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[5]
SUT1	Transporter Info	ChIP sequencing in bone marrow; lung	[4]
SVCT1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
TAPL	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
TAUT	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
THTR1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
UT1	Transporter Info	ChIP sequencing in bone marrow; lung	[2]
UT2	Transporter Info	ChIP sequencing in blood; lung	[3]
VGLUT1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
VIAAT	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[3]
VMAT1	Transporter Info	ChIP sequencing in bone marrow; lung	[5]
ZIP1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
ZIP10	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[2]
ZIP11	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
ZIP13	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
ZIP14	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
ZIP2	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[2]
ZIP3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[3]
ZIP4	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
ZIP5	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
ZIP6	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[2]
ZIP7	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
ZIP8	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[4]
ZIP9	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[5]
ZNT1	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
ZNT2	Transporter Info	ChIP sequencing in bone marrow; lung	[2]
ZNT3	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
ZNT4	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; lung	[4]
ZNT5	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[5]
ZNT6	Transporter Info	ChIP sequencing in blood; bone marrow; liver; lung	[2]
ZNT7	Transporter Info	ChIP sequencing in blood; bone marrow; cervix; liver; lung	[3]
ZNT9	Transporter Info	ChIP sequencing in blood; bone marrow; lung	[4]

Disease-specific Protein Abundances of TF
ICD-11: 01 Certain infectious or parasitic disease
[+] ICD-11: 1C1H Necrotising ulcerative gingivitis		Click to Show/Hide the Full List
The Studied Tissue	Gingival tissue
The Specified Disease	Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.61E-05; Fold-change: 0.344189376; Z-score: 0.548519146
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1E30 Influenza		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.372949457; Fold-change: -0.139775653; Z-score: -0.958993848
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1E51 Chronic viral hepatitis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.740778006; Fold-change: -0.022021511; Z-score: -0.168331746
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 1G41 Sepsis with septic shock		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.83E-15; Fold-change: -0.337933888; Z-score: -0.916145382
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA40 Respiratory syncytial virus infection		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.498851971; Fold-change: -0.000170633; Z-score: -0.000479436
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA42 Rhinovirus infection		Click to Show/Hide the Full List
The Studied Tissue	Nasal epithelium tissue
The Specified Disease	Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.466531798; Fold-change: 0.003079102; Z-score: 0.009907396
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: KA60 Neonatal sepsis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.59E-08; Fold-change: -0.396609792; Z-score: -0.96377786
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 02 Neoplasm
[+] ICD-11: 2A00 Brain cancer		Click to Show/Hide the Full List
The Studied Tissue	Nervous tissue
The Specified Disease	Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.45E-22; Fold-change: -0.678128327; Z-score: -0.698792078
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.475684328; Fold-change: 0.015014646; Z-score: 0.089676235
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	White matter tissue
The Specified Disease	Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.440452993; Fold-change: -0.12547323; Z-score: -0.623384589
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Brain stem tissue
The Specified Disease	Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.02827826; Fold-change: -0.342516016; Z-score: -1.143183457
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A20 Myeloproliferative neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.96E-05; Fold-change: 0.470970399; Z-score: 2.596511056
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.87E-18; Fold-change: 0.369396882; Z-score: 2.145115324
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A36 Myelodysplastic syndrome		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.127791848; Fold-change: 0.095479686; Z-score: 0.359509687
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.215636075; Fold-change: -0.362809472; Z-score: -0.952997125
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A81 Diffuse large B-cell lymphoma		Click to Show/Hide the Full List
The Studied Tissue	Tonsil tissue
The Specified Disease	Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.819242647; Fold-change: -0.144706589; Z-score: -0.416301227
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2A83 Plasma cell neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.41240047; Fold-change: -0.212292059; Z-score: -1.221600367
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Bone marrow
The Specified Disease	Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.016768661; Fold-change: 0.192985432; Z-score: 0.866271302
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B33 Leukaemia		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.62E-13; Fold-change: 0.463343365; Z-score: 0.818702881
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B6E Oral cancer		Click to Show/Hide the Full List
The Studied Tissue	Oral tissue
The Specified Disease	Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.303600798; Fold-change: -0.150940782; Z-score: -0.479751183
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.007394717; Fold-change: 0.200622393; Z-score: 0.291475208
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B70 Esophageal cancer		Click to Show/Hide the Full List
The Studied Tissue	Esophagus
The Specified Disease	Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.258193129; Fold-change: -0.246010597; Z-score: -0.888471691
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: 2B72 Stomach cancer		Click to Show/Hide the Full List
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001223907; Fold-change: 0.475392301; Z-score: 5.254212135
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.08E-08; Fold-change: 0.630593587; Z-score: 1.930010374
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B90 Colon cancer		Click to Show/Hide the Full List
The Studied Tissue	Colon tissue
The Specified Disease	Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.47E-18; Fold-change: -0.562976475; Z-score: -0.80934379
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.30E-05; Fold-change: 0.507693605; Z-score: 0.640066021
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2B92 Rectal cancer		Click to Show/Hide the Full List
The Studied Tissue	Rectal colon tissue
The Specified Disease	Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.885872824; Fold-change: 0.133785341; Z-score: 0.590560666
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.552475727; Fold-change: 0.003059007; Z-score: 0.008020266
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C10 Pancreatic cancer		Click to Show/Hide the Full List
The Studied Tissue	Pancreas
The Specified Disease	Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.828969701; Fold-change: -0.040486706; Z-score: -0.073310572
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.72E-07; Fold-change: -0.361756873; Z-score: -0.974727327
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C12 Liver cancer		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.10E-06; Fold-change: 0.226140608; Z-score: 0.75981592
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.22E-17; Fold-change: 0.332179226; Z-score: 0.791184561
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.12719404; Fold-change: 0.380405585; Z-score: 1.068976341
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual Download TF expression data in the tissue of the other disease section
[+] ICD-11: 2C25 Lung cancer		Click to Show/Hide the Full List
The Studied Tissue	Lung tissue
The Specified Disease	Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.056292987; Fold-change: -0.253322764; Z-score: -0.379908911
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.22E-05; Fold-change: -0.564756747; Z-score: -0.646217113
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C30 Skin cancer		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.046187035; Fold-change: 0.420496839; Z-score: 0.521690144
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Skin
The Specified Disease	Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.11E-12; Fold-change: 0.541791235; Z-score: 0.82246614
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.46E-36; Fold-change: 1.057813412; Z-score: 1.965367217
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C6Z Breast cancer		Click to Show/Hide the Full List
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.04E-30; Fold-change: 0.724726225; Z-score: 0.984647178
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.005395796; Fold-change: 0.448278773; Z-score: 0.477737341
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C73 Ovarian cancer		Click to Show/Hide the Full List
The Studied Tissue	Ovarian tissue
The Specified Disease	Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.042152028; Fold-change: 0.698613003; Z-score: 0.936996564
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.025710236; Fold-change: 0.5389959; Z-score: 0.654493071
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C77 Cervical cancer		Click to Show/Hide the Full List
The Studied Tissue	Cervical tissue
The Specified Disease	Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000225382; Fold-change: 0.176603479; Z-score: 0.830865106
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C78 Uterine cancer		Click to Show/Hide the Full List
The Studied Tissue	Endometrium tissue
The Specified Disease	Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.009257554; Fold-change: -0.526439669; Z-score: -0.719232869
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.011626594; Fold-change: -1.513000469; Z-score: -2.806776114
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C82 Prostate cancer		Click to Show/Hide the Full List
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.200973522; Fold-change: 0.108381992; Z-score: 0.12862816
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C90 Renal cancer		Click to Show/Hide the Full List
The Studied Tissue	Kidney
The Specified Disease	Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.005257688; Fold-change: 0.071909834; Z-score: 0.255154226
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.018617307; Fold-change: -0.564713382; Z-score: -0.912423897
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C92 Ureter cancer		Click to Show/Hide the Full List
The Studied Tissue	Urothelium
The Specified Disease	Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.145017146; Fold-change: 0.182898817; Z-score: 0.792191046
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2C94 Bladder cancer		Click to Show/Hide the Full List
The Studied Tissue	Bladder tissue
The Specified Disease	Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.580683083; Fold-change: -0.098880566; Z-score: -0.119323315
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D02 Retinal cancer		Click to Show/Hide the Full List
The Studied Tissue	Uvea
The Specified Disease	Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.115465772; Fold-change: -0.12287056; Z-score: -0.411127994
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D10 Thyroid cancer		Click to Show/Hide the Full List
The Studied Tissue	Thyroid
The Specified Disease	Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.16648076; Fold-change: -0.113387936; Z-score: -0.187880999
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.36E-05; Fold-change: 0.274195147; Z-score: 0.492208829
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D11 Adrenal cancer		Click to Show/Hide the Full List
The Studied Tissue	Adrenal cortex
The Specified Disease	Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 8.64E-08; Fold-change: 0.639224713; Z-score: 2.020214887
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
[+] ICD-11: 2D12 Endocrine gland neoplasm		Click to Show/Hide the Full List
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000260111; Fold-change: 1.259522531; Z-score: 2.390459443
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Pituitary tissue
The Specified Disease	Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001272757; Fold-change: 1.173077365; Z-score: 2.279029325
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 2D42 Head and neck cancer		Click to Show/Hide the Full List
The Studied Tissue	Head and neck tissue
The Specified Disease	Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.005416411; Fold-change: 0.425851433; Z-score: 0.60950355
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 03 Disease of the blood or blood-forming organs
[+] ICD-11: 3A51 Sickle cell disorder		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.408690957; Fold-change: 0.104935592; Z-score: 0.446031191
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3A70 Aplastic anaemia		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.618072418; Fold-change: -0.108109508; Z-score: -0.506920581
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3B63 Thrombocytosis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.42E-06; Fold-change: 0.355794911; Z-score: 1.979159917
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 3B64 Thrombocytopenia		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.428673546; Fold-change: 0.532338018; Z-score: 0.456474328
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 04 Disease of the immune system
[+] ICD-11: 4A00 Immunodeficiency		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.702724385; Fold-change: 0.065494203; Z-score: 0.315091088
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A40 Lupus erythematosus		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001510415; Fold-change: -0.188396779; Z-score: -0.348651541
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A42 Systemic sclerosis		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.276253997; Fold-change: -0.041048131; Z-score: -0.173304722
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A43 Systemic autoimmune disease		Click to Show/Hide the Full List
The Studied Tissue	Salivary gland tissue
The Specified Disease	Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.23292471; Fold-change: -0.202346584; Z-score: -0.590770157
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.164099018; Fold-change: -0.17016881; Z-score: -0.539101928
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4A62 Behcet disease		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.465933888; Fold-change: -0.052593091; Z-score: -0.080274949
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 4B04 Monocyte count disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.020701814; Fold-change: -0.311380671; Z-score: -0.985876222
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 05 Endocrine, nutritional or metabolic disease
[+] ICD-11: 5A11 Type 2 diabetes mellitus		Click to Show/Hide the Full List
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.32714642; Fold-change: 0.115455823; Z-score: 0.642338446
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Omental adipose tissue
The Specified Disease	Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.445014823; Fold-change: -0.007100699; Z-score: -0.025132653
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Liver tissue
The Specified Disease	Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.372951725; Fold-change: -0.162205465; Z-score: -0.790411186
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5A80 Ovarian dysfunction		Click to Show/Hide the Full List
The Studied Tissue	Vastus lateralis muscle
The Specified Disease	Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.155060634; Fold-change: 0.019820108; Z-score: 0.107964512
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder		Click to Show/Hide the Full List
The Studied Tissue	Biceps muscle
The Specified Disease	Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.55113029; Fold-change: 0.004183299; Z-score: 0.036926325
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C56 Lysosomal disease		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.682492377; Fold-change: -0.04384806; Z-score: -0.379979989
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 5C80 Hyperlipoproteinaemia		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.525964009; Fold-change: -0.063614416; Z-score: -0.159865087
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specified Disease	Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000118811; Fold-change: -0.623140011; Z-score: -2.268515053
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
[+] ICD-11: 6A02 Autism spectrum disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.420216343; Fold-change: -0.084866979; Z-score: -0.301443852
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A20 Schizophrenia		Click to Show/Hide the Full List
The Studied Tissue	Prefrontal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.183991669; Fold-change: -0.178089789; Z-score: -0.358430143
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Superior temporal cortex
The Specified Disease	Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.977351889; Fold-change: 0.100284218; Z-score: 0.303406906
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A60 Bipolar disorder		Click to Show/Hide the Full List
The Studied Tissue	Prefrontal cortex
The Specified Disease	Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.158213826; Fold-change: -0.061002788; Z-score: -0.167886142
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 6A70 Depressive disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.300626709; Fold-change: -0.044898666; Z-score: -0.172166617
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Prefrontal cortex
The Specified Disease	Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.688556552; Fold-change: 0.021775413; Z-score: 0.070754395
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 08 Disease of the nervous system
[+] ICD-11: 8A00 Parkinsonism		Click to Show/Hide the Full List
The Studied Tissue	Substantia nigra tissue
The Specified Disease	Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.381882409; Fold-change: -0.045103781; Z-score: -0.224993614
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A01 Choreiform disorder		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.346861195; Fold-change: 0.010941325; Z-score: 0.039450944
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A20 Alzheimer disease		Click to Show/Hide the Full List
The Studied Tissue	Entorhinal cortex
The Specified Disease	Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.31E-10; Fold-change: -0.35365872; Z-score: -0.638059131
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A2Y Neurocognitive impairment		Click to Show/Hide the Full List
The Studied Tissue	White matter tissue
The Specified Disease	HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.333392286; Fold-change: -0.186590877; Z-score: -0.245136152
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8A40 Multiple sclerosis		Click to Show/Hide the Full List
The Studied Tissue	Plasmacytoid dendritic cells
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.932797321; Fold-change: -0.128611532; Z-score: -0.283870251
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Spinal cord
The Specified Disease	Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.551994049; Fold-change: -0.035273967; Z-score: -0.109530264
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: 8A60 Epilepsy		Click to Show/Hide the Full List
The Studied Tissue	Peritumoral cortex tissue
The Specified Disease	Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.210698164; Fold-change: 0.015437989; Z-score: 0.041463604
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
The Studied Tissue	Whole blood
The Specified Disease	Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.423306429; Fold-change: 0.120820459; Z-score: 0.550449392
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B01 Subarachnoid haemorrhage		Click to Show/Hide the Full List
The Studied Tissue	Intracranial artery
The Specified Disease	Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.192926151; Fold-change: -0.148841928; Z-score: -0.634677292
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B11 Cerebral ischaemic stroke		Click to Show/Hide the Full List
The Studied Tissue	Whole blood
The Specified Disease	Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.09E-11; Fold-change: -0.506811535; Z-score: -2.62149031
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specified Disease	Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.498802257; Fold-change: -0.372956988; Z-score: -0.832362872
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8B60 Motor neuron disease		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.494814132; Fold-change: -0.565203592; Z-score: -0.607218885
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specified Disease	Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.292158301; Fold-change: -0.183197023; Z-score: -0.56583171
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8C70 Muscular dystrophy		Click to Show/Hide the Full List
The Studied Tissue	Muscle tissue
The Specified Disease	Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.29526937; Fold-change: 0.12603373; Z-score: 0.595453413
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: 8C75 Distal myopathy		Click to Show/Hide the Full List
The Studied Tissue	Muscle tissue
The Specified Disease	Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.129656584; Fold-change: -0.14920105; Z-score: -0.244003089
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 09 Disease of the visual system
[+] ICD-11: 9A96 Anterior uveitis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral monocyte
The Specified Disease	Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.054303737; Fold-change: -0.164878247; Z-score: -0.863851618
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 11 Disease of the circulatory system
[+] ICD-11: BA41 Myocardial infarction		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.343821666; Fold-change: 0.273361553; Z-score: 0.328091738
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: BA80 Coronary artery disease		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.052523399; Fold-change: 0.069079523; Z-score: 1.103600596
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: BB70 Aortic valve stenosis		Click to Show/Hide the Full List
The Studied Tissue	Calcified aortic valve
The Specified Disease	Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.574654655; Fold-change: 0.139155128; Z-score: 0.194480954
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 12 Disease of the respiratory system
[+] ICD-11: 7A40 Central sleep apnoea		Click to Show/Hide the Full List
The Studied Tissue	Hyperplastic tonsil
The Specified Disease	Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.309656687; Fold-change: -0.288941844; Z-score: -0.862696176
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA08 Vasomotor or allergic rhinitis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.187032087; Fold-change: 0.223018615; Z-score: 1.02069258
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA0A Chronic rhinosinusitis		Click to Show/Hide the Full List
The Studied Tissue	Sinus mucosa tissue
The Specified Disease	Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.125021126; Fold-change: 0.200200957; Z-score: 0.514209391
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA22 Chronic obstructive pulmonary disease		Click to Show/Hide the Full List
The Studied Tissue	Small airway epithelium
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.357992826; Fold-change: 0.001212463; Z-score: 0.002022047
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Lung tissue
The Specified Disease	Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.779240504; Fold-change: -0.071268166; Z-score: -0.167489233
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CA23 Asthma		Click to Show/Hide the Full List
The Studied Tissue	Nasal and bronchial airway
The Specified Disease	Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.133071001; Fold-change: -0.082162883; Z-score: -0.127097958
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: CB03 Idiopathic interstitial pneumonitis		Click to Show/Hide the Full List
The Studied Tissue	Lung tissue
The Specified Disease	Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.010915437; Fold-change: 0.338456494; Z-score: 1.530026622
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 13 Disease of the digestive system
[+] ICD-11: DA0C Periodontal disease		Click to Show/Hide the Full List
The Studied Tissue	Gingival tissue
The Specified Disease	Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.001799984; Fold-change: 0.306025189; Z-score: 0.479900173
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: DA42 Gastritis		Click to Show/Hide the Full List
The Studied Tissue	Gastric antrum tissue
The Specified Disease	Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.195576244; Fold-change: 0.15577251; Z-score: 2.34858061
TF expression in the diseased tissue of patients TF expression in the normal tissue adjacent to the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data of patients in the normal section of the tissue adjacent to the disease section
[+] ICD-11: DB92 Non-alcoholic fatty liver disease		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.631240556; Fold-change: -0.055568125; Z-score: -0.386617945
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: DB99 Hepatic failure		Click to Show/Hide the Full List
The Studied Tissue	Liver tissue
The Specified Disease	Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.113821256; Fold-change: 0.165305985; Z-score: 0.510230921
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: DD71 Ulcerative colitis		Click to Show/Hide the Full List
The Studied Tissue	Colon mucosal tissue
The Specified Disease	Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.889770367; Fold-change: -0.14280503; Z-score: -0.255441248
TF expression in the diseased tissue of patients TF expression in tissue other than the diseased tissue of patients
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of the other disease section
[+] ICD-11: DD91 Irritable bowel syndrome		Click to Show/Hide the Full List
The Studied Tissue	Rectal colon tissue
The Specified Disease	Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.079119261; Fold-change: -0.235761322; Z-score: -0.55542382
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 14 Disease of the skin
[+] ICD-11: EA80 Atopic eczema		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.630664939; Fold-change: -0.139019769; Z-score: -0.264596391
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: EA90 Psoriasis		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.006972588; Fold-change: -0.06506849; Z-score: -0.093763904
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.97E-24; Fold-change: 0.494188846; Z-score: 1.731270496
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: ED63 Acquired hypomelanotic disorder		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.013589014; Fold-change: 0.266313894; Z-score: 1.815172598
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: ED70 Alopecia or hair loss		Click to Show/Hide the Full List
The Studied Tissue	Skin from scalp
The Specified Disease	Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002574973; Fold-change: -0.133399513; Z-score: -0.510492446
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: EK0Z Contact dermatitis		Click to Show/Hide the Full List
The Studied Tissue	Skin
The Specified Disease	Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.538864171; Fold-change: 0.066957975; Z-score: 0.625071363
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
[+] ICD-11: FA00 Osteoarthritis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.012337942; Fold-change: -0.227638548; Z-score: -1.251065727
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
The Studied Tissue	Synovial tissue
The Specified Disease	Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.745617382; Fold-change: 0.151104615; Z-score: 0.476417871
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA20 Rheumatoid arthritis		Click to Show/Hide the Full List
The Studied Tissue	Synovial tissue
The Specified Disease	Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002294163; Fold-change: 0.875664088; Z-score: 2.032287919
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA24 Juvenile idiopathic arthritis		Click to Show/Hide the Full List
The Studied Tissue	Peripheral blood
The Specified Disease	Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.213235951; Fold-change: 0.019062616; Z-score: 0.062138296
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FA92 Inflammatory spondyloarthritis		Click to Show/Hide the Full List
The Studied Tissue	Pheripheral blood
The Specified Disease	Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.101992849; Fold-change: 0.069088787; Z-score: 0.153302319
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: FB83 Low bone mass disorder		Click to Show/Hide the Full List
The Studied Tissue	Bone marrow
The Specified Disease	Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.008718318; Fold-change: 1.445992224; Z-score: 2.135873521
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 16 Disease of the genitourinary system
[+] ICD-11: GA10 Endometriosis		Click to Show/Hide the Full List
The Studied Tissue	Endometrium tissue
The Specified Disease	Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.575087795; Fold-change: -0.009039109; Z-score: -0.023335835
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: GC00 Cystitis		Click to Show/Hide the Full List
The Studied Tissue	Bladder tissue
The Specified Disease	Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.573934701; Fold-change: 0.057299135; Z-score: 0.106022783
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 19 Certain condition originating in the perinatal period
[+] ICD-11: KA21 Short gestation disorder		Click to Show/Hide the Full List
The Studied Tissue	Myometrium
The Specified Disease	Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.04401315; Fold-change: -0.304724669; Z-score: -0.953110127
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
ICD-11: 20 Developmental anomaly
[+] ICD-11: LD2C Overgrowth syndrome		Click to Show/Hide the Full List
The Studied Tissue	Adipose tissue
The Specified Disease	Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.766011692; Fold-change: 0.00461441; Z-score: 0.01521721
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual
[+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome		Click to Show/Hide the Full List
The Studied Tissue	Perituberal tissue
The Specified Disease	Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.054370142; Fold-change: -0.407595741; Z-score: -1.123496559
TF expression in the diseased tissue of patients TF expression in the normal tissue of healthy individuals
		Please Click the above Thumbnail to View/Download the Expression Barchart for All Samples
Download TF expression data of patients in the disease section of the tissue Download TF expression data in the tissue of healthy individual

References
1	Genomic organization and expression of the mouse equilibrative, nitrobenzylthioinosine-sensitive nucleoside transporter 1 (ENT1) gene. Biochem Biophys Res Commun. 2000 Oct 14;277(1):200-8.
2	The Encyclopedia of DNA elements (ENCODE): data portal update. Nucleic Acids Res. 2018 Jan 4;46(D1):D794-D801
3	hTFtarget: A Comprehensive Database for Regulations of Human Transcription Factors and Their Targets. Genomics Proteomics Bioinformatics. 2020 Apr;18(2):120-469.
4	NCBI GEO: archive for functional genomics data sets--update. Nucleic Acids Res. 2013 Jan;41(D1):D991-5.
5	Closure of the NCBI SRA and implications for the long-term future of genomics data storage. Genome Biol. 2011;12(3):402.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

Transcription Factor (TF) Information

Visitor Map

Correspondence